PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco013405.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family G2-like
Protein Properties Length: 365aa    MW: 40134.6 Da    PI: 6.7627
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco013405.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.12e-28180229251
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                  pr+rWt+ LH+rFv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  Aco013405.1 180 PRMRWTSALHARFVHAVDLLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 229
                  9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-13177230IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.9E-25178229IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-21180230IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MPSPDLSLNI SPPSNNCPST APNLDRDLGL DLLLRPVEPT HADVSHARTD LSLSSTNHMT  60
SLFDIATPIR GLPSYNTPPS SSPERGHDPQ ISLHPSNPHS SFSSSSSAYG GLPAFGSPYH  120
RIIAPPTSFG GYAFDPMRSD HYQYYNINQY GVGAFESSQS MIRSRIFVPK FPTKRNMRAP  180
RMRWTSALHA RFVHAVDLLG GHERATPKSV LELMDVKDLT LAHVKSHLQV CPFSNHSTRT  240
VKSTEKPATS PDQSECSGEE DFTPMLTDFG LRRSMSSQGD SNAPLHQHDK DSITMWNNPS  300
IKGGWLQMNS CELEDHASMT ASSQFQDGDH LCHSSGSSRP HQELKIPSLE FTLGRPDWLG  360
TENC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-15181229452Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-15181229452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-15181229452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-15181229452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-15181229452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-15181229452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-15181229452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-15181229452Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020104171.10.0probable transcription factor RL9 isoform X4
SwissprotQ0J2352e-47ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A2H3YG993e-83A0A2H3YG99_PHODC; probable transcription factor RL9 isoform X3
STRINGXP_008798291.11e-78(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.12e-48G2-like family protein