PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco013324.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family M-type_MADS
Protein Properties Length: 239aa    MW: 25850.9 Da    PI: 8.6411
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco013324.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF70.91.2e-22957149
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                 kri+n+  rqv fskRr+g++KKA+ELS+LC+ae+ v++fs+ gk + +
  Aco013324.1  9 KRIQNEEARQVCFSKRRTGLFKKASELSILCGAEIGVVVFSPAGKAFSF 57
                 79******************************************97766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554557.33E-29171IPR002100Transcription factor, MADS-box
PROSITE profilePS5006627.319161IPR002100Transcription factor, MADS-box
SMARTSM004321.7E-35160IPR002100Transcription factor, MADS-box
CDDcd002651.32E-39278No hitNo description
PRINTSPR004041.2E-21323IPR002100Transcription factor, MADS-box
PfamPF003192.7E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-212338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-213859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009559Biological Processembryo sac central cell differentiation
GO:0043078Cellular Componentpolar nucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MGRQKIEIKR IQNEEARQVC FSKRRTGLFK KASELSILCG AEIGVVVFSP AGKAFSFGHP  60
SVDAVVDRFL TDSSSGSNNG GQHGAAAATV RELNRQYVEL HGLLEAEKKR REGVEAAMER  120
ERAGRACWWD ANVDALGVDE LQAFQKALCD LRAAVAKRAD QLLHDALSRK QQQQQQQHQQ  180
QQHQHQHYMQ MQIPSTSAAA AAANGPTLGA VKNEDAAAHV SLGGSGFGFG YGFYGGAF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-17169169MEF2C
5f28_B2e-17169169MEF2C
5f28_C2e-17169169MEF2C
5f28_D2e-17169169MEF2C
6byy_A2e-17169169MEF2 CHIMERA
6byy_B2e-17169169MEF2 CHIMERA
6byy_C2e-17169169MEF2 CHIMERA
6byy_D2e-17169169MEF2 CHIMERA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020104108.11e-125agamous-like MADS-box protein AGL61
TrEMBLA0A199ULX01e-174A0A199ULX0_ANACO; Agamous-like MADS-box protein AGL61
STRINGXP_008791999.14e-81(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.15e-36AGAMOUS-like 61