PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco012845.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family CAMTA
Protein Properties Length: 1033aa    MW: 117208 Da    PI: 7.3477
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco012845.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-11621.1e-501232355117
         CG-1   5 kkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcywlL 102
                   +rw +++e++aiL n+++++++ ++ ++p+sg+++L++rk++r+frkDG++wkkkkdgktv+E+hekLK+g+ve +++yYa+ e++p+f rr+ywlL
  Aco012845.1 123 PNRWFRPNEVHAILSNYARFKIQPQPVDKPQSGTVLLFDRKMLRNFRKDGHNWKKKKDGKTVQEAHEKLKIGNVERIHVYYARCEDDPNFYRRSYWLL 220
                  68************************************************************************************************ PP

         CG-1 103 eeelekivlvhylev 117
                  ++ le+ivlvhy+++
  Aco012845.1 221 DKMLERIVLVHYRQT 235
                  ************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143772.915115241IPR005559CG-1 DNA-binding domain
SMARTSM010761.7E-62118236IPR005559CG-1 DNA-binding domain
PfamPF038592.6E-44123234IPR005559CG-1 DNA-binding domain
SuperFamilySSF812965.6E-13477564IPR014756Immunoglobulin E-set
SuperFamilySSF484033.11E-16657784IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.1E-15667784IPR020683Ankyrin repeat-containing domain
CDDcd002044.02E-14667777No hitNo description
PROSITE profilePS5029716.255685789IPR020683Ankyrin repeat-containing domain
PfamPF127964.4E-8691781IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5008811.14718750IPR002110Ankyrin repeat
SMARTSM002481.9E-5718747IPR002110Ankyrin repeat
SMARTSM00248260757786IPR002110Ankyrin repeat
PROSITE profilePS500966.998870896IPR000048IQ motif, EF-hand binding site
SuperFamilySSF525402.42E-6871936IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.39885907IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500967.236886913IPR000048IQ motif, EF-hand binding site
PfamPF006120.0011888906IPR000048IQ motif, EF-hand binding site
SMARTSM000151.3908930IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.322910933IPR000048IQ motif, EF-hand binding site
PfamPF006120.0033911929IPR000048IQ motif, EF-hand binding site
SMARTSM000152.29901012IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.9199921020IPR000048IQ motif, EF-hand binding site
PfamPF006120.249931012IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1033 aa     Download sequence    Send to blast
MLHTLSLDTP KLEPSNLQLT VKIPRSVHRY PVYLTPRRRI TVHALLAPSP FLPALPLSFS  60
LSSDTKLRGR SYLPFLFSIT SSARVSPSSP FAAMEGGLLL DGEIHGFHTA SDLDVEKLME  120
DAPNRWFRPN EVHAILSNYA RFKIQPQPVD KPQSGTVLLF DRKMLRNFRK DGHNWKKKKD  180
GKTVQEAHEK LKIGNVERIH VYYARCEDDP NFYRRSYWLL DKMLERIVLV HYRQTSEDHA  240
SQYLPAPVDC TENLSLISKI HHDSPSTPIE SNSASAHSVV SGSAGTSEEI NSGEDNTVQA  300
ELQSHEFSLH EINTLDWDDL LESPTNNDST QHRDGDFFIS DQQIQNELAK SMNNGSFFMP  360
HNTSCITDND GAGNDQTIGS YFQAMKDQES QSQLLNSTKS ESQTEDRTSN AITGTSTPDN  420
ITNDVFLSQN SLGRWNYLND DINLLDDLQL EPLRSEANKL ATCTLMDQSS NQQPIFNITD  480
VSPGWAYSTE ETKVLVVGYF YEQQKHLMET QVYCGFGRKC VPAELVQAGV YRCTAAPSEP  540
GFVNLYLTLD GQTPISQVWS FEYRSKLSVW DEVASSEDDN RKLKLKEFQM QMRLAHLLFS  600
TSGNVSGLSG RTQQKFLKEA KNFASLSSSL MEKEWLNMLK LVNSNRDSQM PATEELLELV  660
LRNKLQEWLL EKVAEGRRTT PCDIQGQGVI HLCAILDYPW AVYLFSLSGF SLDFRDACGW  720
TALHWAAYYG RERMVATLLS AGANPSLVTD PTPESPGGST AADLAAKQGY EGLAAYLAEK  780
GLTAHFQAMS LSGNVATAAP FSTKKVNFES TDIENLSEQE LCLKESLAAY RNAADAADRI  840
QAAFRERSLK LQTKAVQMSK PEMEASEIVA ALKIQHAFRN HNRRKLMRAA AQIQSHFRTW  900
KTRKNFLHVR RQVIRIQAAF RGHQVRKQYC KIIWSVGVLE KAILRWRLKR RGLRGIHTEA  960
PSEAMRVDTE PANTEEEEFF RISREQAEER VKRSVIRVQT MFRSYRAQQE YRRMRMAHEK  1020
AKLEFNQMGH FY*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00435DAPTransfer from AT4G16150Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008786234.10.0PREDICTED: calmodulin-binding transcription activator 5-like isoform X1
TrEMBLK3ZQI20.0K3ZQI2_SETIT; Uncharacterized protein
STRINGSi028862m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP98312933
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16150.10.0calmodulin binding;transcription regulators