PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco012759.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family Dof
Protein Properties Length: 272aa    MW: 29697.5 Da    PI: 8.4923
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco012759.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.8e-3973130461
       zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                    lkcprCdst+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk++
  Aco012759.1  73 VPLKCPRCDSTHTKFCYYNNYSLSQPRYFCKTCRRYWTKGGSLRNVPVGGGCRKNKRH 130
                  5789***************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2768129IPR003851Zinc finger, Dof-type
PfamPF027016.1E-3374129IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.35775129IPR003851Zinc finger, Dof-type
PROSITE patternPS01361077113IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010067Biological Processprocambium histogenesis
GO:0010087Biological Processphloem or xylem histogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MATPSMHICM DSSSDWLKGL FPEETLTPSS SAAAAAASAD LLLTYPTIPI HSQPLSVPLH  60
ERRARQGPPH EQVPLKCPRC DSTHTKFCYY NNYSLSQPRY FCKTCRRYWT KGGSLRNVPV  120
GGGCRKNKRH PPPPHSADKK PSNHHPHHAA AAAATSFGLH LSFSPPLPTT ITTCHNLNFF  180
NHKYNSLLDS QFYTYGNNNS SSSGNRILME DPGNTIAETK PTTAETRDLP LLEWQEQCCA  240
DIVGREAPCA GLGLWAAAGM IGGGHHGRSP AL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00580DAPTransfer from AT5G62940Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF5425079e-77AF542507.1 Oryza sativa Dof-like protein 34 mRNA, partial cds.
GenBankCP0126109e-77CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020088039.10.0dof zinc finger protein DOF5.6-like
TrEMBLA0A199UHQ20.0A0A199UHQ2_ANACO; Dof zinc finger protein DOF5.3
STRINGXP_008795919.11e-55(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62940.12e-34Dof family protein