PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco012631.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 276aa    MW: 29925.5 Da    PI: 6.0682
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco012631.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_147.83.2e-15227269547
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                  +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++Lkk
  Aco012631.1 227 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLKK 269
                  79***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.8E-14218270No hitNo description
SMARTSM003382.1E-8223274IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.702225270IPR004827Basic-leucine zipper domain
PfamPF001706.6E-13227270IPR004827Basic-leucine zipper domain
CDDcd147072.96E-23227272No hitNo description
SuperFamilySSF579595.06E-11227270No hitNo description
PROSITE patternPS000360230245IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MALQGGGGGG GGGPSQIESL ARQGSLYNLT LNEVESHLGE PLHSMNLDEL LKSVLPIEMN  60
QSLPAMDESS TSEHPLGPGL LRQGSITMPQ GLSKKTVDEV WRDIQQGGKK GSEEGHKGRR  120
ERQTTLGEMT LEDFLVKAGV VTNELIANVG QGGSADPMAG QQDFTQGGHW YQQGVMGGYP  180
VLNASYSEGG QMSISSQMMG ALSDSQMPGR KRAAAPSEDV EDKLVERRQK RMIKNRESAA  240
RSRARKQAYT NELENKVSRL EEENERLKKQ KVDVF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010931491.11e-109PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES33e-76AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLA0A0A9HCS14e-91A0A0A9HCS1_ARUDO; Uncharacterized protein
STRINGGRMZM2G159134_P022e-87(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-72ABA-responsive element binding protein 3