PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco012493.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family LBD
Protein Properties Length: 177aa    MW: 19657.3 Da    PI: 6.8596
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco012493.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.11.8e-44101091100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +Ca+Ck+lrr+CakdC++apyfp ++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++ql+ +la+++
  Aco012493.1  10 PCASCKLLRRRCAKDCIFAPYFPPDDPHKFAIVHKVFGASNVSKMLQELPVHQRGDAASSLVYEANARVRDPVYGCVGAISYLQNQVAQLQMQLAMAQ 107
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Aco012493.1 108 AE 109
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.8619110IPR004883Lateral organ boundaries, LOB
PfamPF031953.3E-4410107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MDRKTGGSSP CASCKLLRRR CAKDCIFAPY FPPDDPHKFA IVHKVFGASN VSKMLQELPV  60
HQRGDAASSL VYEANARVRD PVYGCVGAIS YLQNQVAQLQ MQLAMAQAEI LCVQMQQETP  120
FAREQKIGID DDDDHDDKHF MLQHSGFSHG VNQFMSFSSP GTNVVQEPLK RESLWA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-4961117112LOB family transfactor Ramosa2.1
5ly0_B8e-4961117112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020102144.11e-131LOB domain-containing protein 12-like
SwissprotQ8LBW38e-78LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A199VID91e-129A0A199VID9_ANACO; LOB domain-containing protein 12
STRINGVIT_06s0004g07200.t016e-87(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88238150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.14e-69LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]