PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco012185.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family LBD
Protein Properties Length: 114aa    MW: 12831.5 Da    PI: 9.7229
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco012185.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26037.56.5e-12419249100
       DUF260  49 lpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                  lp ++r +a++++  eA +r++dPvyG+vgvi+ lqq++   + ela+++++
  Aco012185.1  41 LPVHQRAQAAEAMSAEAYWRVQDPVYGSVGVINLLQQHIYMNQRELARTRAH 92 
                  6889*******************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.75923114IPR004883Lateral organ boundaries, LOB
PfamPF031957.1E-104190IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MSTSSHNSNN TSPSPIINES NQRRCAACKY LRKRCSRDCQ LPVHQRAQAA EAMSAEAYWR  60
VQDPVYGSVG VINLLQQHIY MNQRELARTR AHIAIHSPTR GPCSPWAGLW TSPI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020083393.14e-74LOB domain-containing protein 24-like
TrEMBLA0A199W1I43e-79A0A199W1I4_ANACO; LOB domain-containing protein 24 (Fragment)
STRINGXP_008801576.13e-31(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52823562
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.19e-16LOB domain-containing protein 24