PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco011950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family Nin-like
Protein Properties Length: 927aa    MW: 103810 Da    PI: 6.2698
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco011950.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK87.31.3e-27617667252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  ek i l+d++k+F++ +kdAA++Lgvc+T+LKriCRq+GI+RWP+Rkik++
  Aco011950.1 617 EKAIGLQDIQKHFAGCLKDAARSLGVCPTTLKRICRQHGISRWPSRKIKKV 667
                  799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.052606687IPR003035RWP-RK domain
PfamPF020428.0E-25620667IPR003035RWP-RK domain
SuperFamilySSF542771.05E-23822911No hitNo description
Gene3DG3DSA:3.10.20.2407.9E-25825909No hitNo description
SMARTSM006666.8E-27828911IPR000270PB1 domain
PROSITE profilePS5174525.701828911IPR000270PB1 domain
PfamPF005642.2E-18829908IPR000270PB1 domain
CDDcd064071.69E-38829910No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 927 aa     Download sequence    Send to blast
MEEAVRAEGL RGRRAFSDSA EGLDLLMDEL LAAQCFDCFD LSQPGSASLA SPFCSSGFSP  60
PFDASNASSN PILREPDTGD DTERSTFSSN LLASEDAWTW IETIPSTSSN ELILRRPRSE  120
TSINLSFIPR GPVVTVEDRL ISALNYIKDS QKDGDFLVQI WAPTLLENRP VLTTRGRPFS  180
LDSSCQRLRN FRSVSVNYHF SADEYAYEPL GLPGRVFVGK VPEWTPDVRY FNDYEYPRVD  240
HAKYYDVRGT IALPIFERHD RSCLGVVELV TTIQKINYGY DVESICNALQ SVDLRSSEVS  300
TFRSKKVSNN SYRTVIPEIQ RVLRAVCDNH RLPLAQTWIS CIQQGKRGSR HSDETYKDCI  360
STVDDACYVR NPSMLGFHEA CAEHHLFRGQ GVAGRAFMTN QPCFSEDITA YDKVVYPLSH  420
HAKLFNLKAA VAIRLRSIHT GNADFVLEFF LPVDCVGSEE QKLILNSLSI TIQQVCQSLR  480
VVTANELEAE ALLYELTPTY PTPTDMLFER VEPNDESNIV PVGTPTIGVF GEDSSWITTF  540
TDSQKRGGGN FEISNNSVMT EWGRSEMVLP AGKIFSELKQ HREDSLKNSA DHTSAFVRKT  600
SFLNLEKSTE KRRSKTEKAI GLQDIQKHFA GCLKDAARSL GVCPTTLKRI CRQHGISRWP  660
SRKIKKVGHS LKKLQVVIDS VHGAEGAFQF SSLYENFTKG AWSDKDLMGT TSYSTVLKQN  720
DQPESSNTKQ QQEIRFISHT SGSNSLSFSS CTQSSTSSLG CSSGLEQHAN TSELTIKQET  780
SVEENQAGMF KKSRSLELQG SAKDTPVPLA RSQSHAENLS ILQNRHDSLK IKAIYGEDKV  840
IFRLQPNWGF EDLKQEIMRR FNIANSIPVD LKYLDEDSEW ILLTCDADLQ ECVDVYKSLN  900
AHTVKILVYH NAELNMRSFF GQTGLS*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020084736.10.0protein NLP1-like
RefseqXP_020084737.10.0protein NLP1-like
SwissprotQ10S830.0NLP1_ORYSJ; Protein NLP1
TrEMBLA0A199VL690.0A0A199VL69_ANACO; Protein NLP1 (Fragment)
STRINGXP_008812750.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110253241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76350.10.0Nin-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]