PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco011677.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family M-type_MADS
Protein Properties Length: 191aa    MW: 21248.8 Da    PI: 6.7979
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco011677.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF29.31.1e-091056249
                 ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                 +i +k nr + fskRr+g++KKA+ L    + ++av+ f ++g+ + y
  Aco011677.1 10 PIIDKHNRFICFSKRRAGLFKKANQLAR-RGFQIAVLAFTESGNAFAY 56
                 6889********************9985.6788888888888876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006616.512160IPR002100Transcription factor, MADS-box
SMARTSM004322.1E-12159IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.54E-17273IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-6323IPR002100Transcription factor, MADS-box
PfamPF003193.0E-111156IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-62338IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MGRRKIKIEP IIDKHNRFIC FSKRRAGLFK KANQLARRGF QIAVLAFTES GNAFAYGSPK  60
VEEVVERFLH NSDATDGAGS SKATESLIKA PEDCKEQEQT EKVSSESAES AQQKDVSRET  120
KERAEDGEDS WNSLSSALTE SKHFWWNSSV ENLSLKNLLQ FKSALEALLT SVRIKADSLL  180
VEQDFLAGFT *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020094012.11e-137agamous-like MADS-box protein AGL29
TrEMBLA0A199VNG31e-133A0A199VNG3_ANACO; Agamous-like MADS-box protein AGL29
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP782923
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.19e-21AGAMOUS-like 29