PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco011374.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family M-type_MADS
Protein Properties Length: 421aa    MW: 49214.8 Da    PI: 10.4235
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco011374.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF40.73.1e-13146187950
                  HHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF   9 rqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 
                  r   + kR++g+ KK +ELS+LC++++ ++ ++++g + +++
  Aco011374.1 146 RRECYRKRKEGLKKKIFELSTLCGVNAFLVCYGPSGDVVTWP 187
                  566799***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.2E-4130188IPR002100Transcription factor, MADS-box
PROSITE profilePS5006612.503130190IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.18E-17132223IPR002100Transcription factor, MADS-box
PfamPF003192.0E-13143186IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MPRSKEGVGK KGKRRRSSDR FSTPPPPPPL PPLGRGRRRR GQKKEREREK REGEGKKRRR  60
GRRRKEKKQR PLPLLRRYRR RLGEGEGEGE GEGEREVGRR RRGKKRREKE QRPFPPLRRH  120
RLGEGEGEGR RRGRRRERRR RCDEKRRECY RKRKEGLKKK IFELSTLCGV NAFLVCYGPS  180
GDVVTWPPDD HALRELVEKY ESLTAETKAK HNLNMSSYLL SEIQKQQKRL NKIMAADDLL  240
TRWNGRRLDD MTEVELQELL QLLDETMLKR ARRRITYLYS EKCFDESLES GPCFTPPTPF  300
ADEDVNFAHL YGGKRFDESL ESGGAKTVPC FTYPTTPLAD EDDNVTSYYS GKCSNESVES  360
SHAETIPWLT YPTTLLADED DGDMFKPYRD PFDWLFSRRR ALGGSELRQE QCVLPFGLQH  420
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13341GRGRRRRGQ
25460GKKRRRG
36068GRRRKEKKQ
46166RRRKEK
56381RKEKKQRPLPLLRRYRRRL
6100107RRGKKRRE
7103108KKRREK
8129139RRRGRRRERRR
9130138RRGRRRERR
10133146RRRERRRRCDEKRR
11138153RRRCDEKRRECYRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020080835.11e-153MADS-box transcription factor PHERES 1-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143511825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G27050.11e-10AGAMOUS-like 101