PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco011022.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family Dof
Protein Properties Length: 365aa    MW: 38334.6 Da    PI: 7.9423
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco011022.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.44.2e-403091263
       zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63
                 +e++lkcprC+stntkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rknk+sss
  Aco011022.1 30 PEQSLKCPRCESTNTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKNKRSSS 91
                 7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-282888IPR003851Zinc finger, Dof-type
PfamPF027012.5E-333288IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.4223488IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103672IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MGSSTLPLEE VLASCPKPQQ QERKVVRPQP EQSLKCPRCE STNTKFCYYN NYSLSQPRYF  60
CKGCRRYWTK GGSLRNVPVG GGCRKNKRSS SNSSSNSSST SPSNSSSSSK RPQDHHQTHL  120
MITTSSVITP SLSTLFPPHQ LSYDPSDLSL AFARLHKQPA AAPGELGLAH HEHDPSFLLL  180
ANPNPNPNPN PNPSPGCMIP PYSGPGFLDI LRGGFLDTIT PHPHPNGFNS LFYGWGGNNG  240
NGLQEVEGVG GGEKEEVVVP LNGGLMGGGA AAAAAAAAAT ATATATTTTA TTVTTSQLEP  300
CRALDHGGES KNILMGGLQW QLGGDGNLAV DSAGRDFWNV NGVASSSSST SCTSWHGIIN  360
SSLM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020085850.10.0dof zinc finger protein PBF-like
TrEMBLA0A199UTZ30.0A0A199UTZ3_ANACO; Dof zinc finger protein DOF5.3
STRINGXP_008789033.14e-94(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.13e-36TARGET OF MONOPTEROS 6