PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco010661.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 280aa    MW: 30667.3 Da    PI: 6.0619
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco010661.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.62e-11149196552
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                  kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++  l
  Aco010661.1 149 KRVKRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSALSPRVAFL 196
                  8999*********************************99998776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.5E-13145209IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.76147203IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.8E-14149203No hitNo description
PfamPF001704.8E-10149199IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.34E-11149203No hitNo description
CDDcd147038.85E-24150200No hitNo description
PROSITE patternPS000360152167IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MAQLPPRIPS IAGNWAVNFE RSPTMSAPQQ PSWVDEFLCF SAARRGAHRR SVSDSVAFLE  60
APLADCSAVV GGGGGEFDRL DDDQLMSMFS DDVPPPAPVV SSSNPSTPSD HNSINEDQKT  120
AAEQQAEEAQ SEEEQPAPGP EPTTFVDPKR VKRILANRQS AQRSRVRKLQ YISELERSVT  180
SLQTEVSALS PRVAFLDHQR SLLTVGNSHL KQRIAALAQD KIFKDAHQEA LKKEIERLRR  240
VYEQQQNLKK MASPASDASV RGEKELLGRE GAAMLCPPS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009406251.11e-119PREDICTED: transcription factor RF2a-like isoform X1
SwissprotQ9M2K45e-95BZP61_ARATH; Basic leucine zipper 61
TrEMBLE0CTM61e-107E0CTM6_VITVI; Putative uncharacterized protein
STRINGVIT_12s0028g02590.t011e-107(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G58120.19e-58bZIP family protein