PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco009998.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family BES1
Protein Properties Length: 329aa    MW: 34692.7 Da    PI: 9.3272
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco009998.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822212.98.2e-6631492149
       DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslk 99 
                  ++gr ptw+ErEnn+rRERrRRaiaakiyaGLRa+Gny+lpk++DnneVlkALc+eAGw+v++DGttyr+g+kp+e+a+++g sas sp+ss+q s++
  Aco009998.1   3 TGGRLPTWRERENNRRRERRRRAIAAKIYAGLRAHGNYPLPKHCDNNEVLKALCAEAGWTVHPDGTTYRNGCKPPENADIIGGSASPSPCSSYQPSPR 100
                  799*******************************************************************************************9999 PP

       DUF822 100 ssalaspvesysaspksssfpspssldsislasaasllpvlsvlslvsss 149
                  +s+ +sp +s+ asp+sss+ + ss   +++ s++sl+p+l++ls++++s
  Aco009998.1 101 ASYNPSPSSSSLASPASSSYIAHSSNFINNI-SNSSLIPWLKNLSSSPAS 149
                  9999999999999999999998888555555.579*********997665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056875.3E-674144IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MTTGGRLPTW RERENNRRRE RRRRAIAAKI YAGLRAHGNY PLPKHCDNNE VLKALCAEAG  60
WTVHPDGTTY RNGCKPPENA DIIGGSASPS PCSSYQPSPR ASYNPSPSSS SLASPASSSY  120
IAHSSNFINN ISNSSLIPWL KNLSSSPASS SKFPHLPSLH IPGGSISAPV TPPISSPTAR  180
TPRFKTDFND LNILPPWASP NCASLLNSTP PSPGRQTGPN PAWLAGIQIS SAGPLSPTFS  240
FVSSNPFGIF KEAVAGGSSS QMCTPGQSGT CSPVMGGSAG RGVPDEFAFR SNHVKGLVKA  300
WEGERIHEEC GSDELELTLG SSRTRADA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zd4_A2e-23676372442Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_B2e-23676372442Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_C2e-23676372442Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
5zd4_D2e-23676372442Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMay function in brassinosteroid signaling. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0040704e-73AP004070.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OJ1705_E12.
GenBankAP0149584e-73AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126104e-73CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020096869.10.0protein BZR1 homolog 3-like
SwissprotQ5Z9E51e-132BZR3_ORYSJ; Protein BZR1 homolog 3
TrEMBLA0A199W6420.0A0A199W642_ANACO; Protein BZR 3
STRINGOMERI06G17170.11e-132(Oryza meridionalis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP136638112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.12e-80BES1/BZR1 homolog 4
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]