PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco009991.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family HSF
Protein Properties Length: 99aa    MW: 10623.9 Da    PI: 10.3542
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco009991.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind75.78.2e-243391260
                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                  F+ k+y++++d++++++i w +++nsfvv+d+  f++++Lp  Fkh+nf+SFvRQLn+Y
   Aco009991.1 33 FVVKTYRMVNDPSTDSVIAWGRENNSFVVVDPFVFSQTLLPANFKHNNFSSFVRQLNTY 91
                  9********************999**********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004158.6E-152998IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA:1.10.10.102.5E-253192IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467852.18E-223291IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000563.2E-133356IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004473.3E-193391IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.2E-137183IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.2E-138496IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 99 aa     Download sequence    Send to blast
MEKYGGGKIS RNGNNSSNNG SGGGGGAVVA APFVVKTYRM VNDPSTDSVI AWGRENNSFV  60
VVDPFVFSQT LLPANFKHNN FSSFVRQLNT YVRTLTIF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5w_B1e-173091162Putative transcription factor
5d5x_B1e-173091162Putative transcription factor
5d5x_E1e-173091162Putative transcription factor
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2485388e-38AK248538.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf61l22, mRNA sequence.
GenBankAK3544358e-38AK354435.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1007F06.
GenBankAK3581368e-38AK358136.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1069K14.
GenBankAK3703998e-38AK370399.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2110B13.
GenBankHM4460418e-38HM446041.1 Hordeum vulgare subsp. vulgare heat shock factor C2b (HsfC2b) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020097737.11e-59heat stress transcription factor C-2a-like, partial
SwissprotQ6EUG41e-31HFC2A_ORYSJ; Heat stress transcription factor C-2a
TrEMBLA0A199W4Z01e-56A0A199W4Z0_ANACO; Heat stress transcription factor C-2a
STRINGXP_008795220.13e-33(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24520.12e-29heat shock transcription factor C1
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]