PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco009912.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family LBD
Protein Properties Length: 172aa    MW: 18800.5 Da    PI: 10.5501
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco009912.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260117.11e-3661061101
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  aCaaCk++rr+C ++C+la++fpae++++f+ vh+lFG+sn++++  a+p++ r++a++++v+eAear rdPv+G++g++++l+ +++ ++ e+a+++
  Aco009912.1   6 ACAACKHQRRRCWPGCALARHFPAERAAEFRSVHRLFGVSNLMRIHGAAPPHLRDHAVRAMVFEAEARRRDPVHGCLGLVRSLSARINAVAREIAAVR 103
                  7**********************************************************************************************999 PP

       DUF260  99 eel 101
                  +++
  Aco009912.1 104 RQI 106
                  875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.2725106IPR004883Lateral organ boundaries, LOB
PfamPF031951.1E-336103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MRGGQACAAC KHQRRRCWPG CALARHFPAE RAAEFRSVHR LFGVSNLMRI HGAAPPHLRD  60
HAVRAMVFEA EARRRDPVHG CLGLVRSLSA RINAVAREIA AVRRQIDRHR TRDAFATGFP  120
EEIGCSGALM KSIVVGSSEA AEPSLSSSPS TNYSMTFKPH CTVEDGVETR N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-2841099114LOB family transfactor Ramosa2.1
5ly0_B1e-2841099114LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020097827.11e-122LOB domain-containing protein 25-like
TrEMBLA0A199VZA97e-77A0A199VZA9_ANACO; Protein LATERAL ORGAN BOUNDARIES
STRINGXP_008797789.13e-36(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP158291113
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.17e-29LOB domain-containing protein 22