PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco009564.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family CAMTA
Protein Properties Length: 1038aa    MW: 116148 Da    PI: 5.639
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco009564.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1181.78.5e-57201362118
         CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfqrrcy 99 
                  l+ ++rwl++ ei++iL n++k++++ e+++rp+sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+he+LK g+v+vl+cyYah+een++fqrr+y
  Aco009564.1  20 LEAQHRWLRPAEICEILRNYRKFRIAPEPPNRPPSGSLFLFDRKVLRYFRKDGHNWRKKKDGKTVKEAHERLKAGSVDVLHCYYAHGEENENFQRRSY 117
                  5679********************************************************************************************** PP

         CG-1 100 wlLeeelekivlvhylevk 118
                  w+Leee+ +ivlvhy+evk
  Aco009564.1 118 WMLEEEFMHIVLVHYREVK 136
                  ****************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143784.50615141IPR005559CG-1 DNA-binding domain
SMARTSM010761.5E-7918136IPR005559CG-1 DNA-binding domain
PfamPF038594.0E-5021134IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.101.3E-8451536IPR013783Immunoglobulin-like fold
CDDcd001023.59E-4451538No hitNo description
PfamPF018333.8E-10452529IPR002909IPT domain
SuperFamilySSF812962.49E-18452537IPR014756Immunoglobulin E-set
SuperFamilySSF484033.58E-17636748IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029717.263637748IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.204.7E-17638749IPR020683Ankyrin repeat-containing domain
CDDcd002045.41E-14643746No hitNo description
PROSITE profilePS500888.897687719IPR002110Ankyrin repeat
SMARTSM002480.015687716IPR002110Ankyrin repeat
SMARTSM00248390726755IPR002110Ankyrin repeat
SuperFamilySSF525406.9E-8860913IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.16862884IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.517863892IPR000048IQ motif, EF-hand binding site
PfamPF006120.0033865883IPR000048IQ motif, EF-hand binding site
SMARTSM000150.0092885907IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.615886910IPR000048IQ motif, EF-hand binding site
PfamPF006124.6E-4888907IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0010150Biological Processleaf senescence
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 1038 aa     Download sequence    Send to blast
MADARRYALT PQLDIEQILL EAQHRWLRPA EICEILRNYR KFRIAPEPPN RPPSGSLFLF  60
DRKVLRYFRK DGHNWRKKKD GKTVKEAHER LKAGSVDVLH CYYAHGEENE NFQRRSYWML  120
EEEFMHIVLV HYREVKGGRP NFSRSREVEE VAQVSHTDSP ACSNSFTSQS HIPSQTTDAE  180
SPNSGQTSEY EDAESDNYPT SSRYNPIPEM RQYEDGRGHV MDAPLLNPYV SIPSPTTPPI  240
SDYYSVAQED TTTVFDGTGG GLTFSGSKTT QLELASWDEV LAHCTTGFQT PYVQPSVGSR  300
QATAFEDNSS LETITFGEAY NNDLLPKEVY GIGAEGKLLW QHPSPASGSL GIDGEYGRSI  360
EENIGHSPLT KQASLDLSHL EADGLKKYDS FSRWMSKELE EVDDSQLRSN SEPYWNTVDD  420
ESVVESSNIS NHEPLDSYAV SPSLSQDQLF SIIDFSPSWA FASLETKVLI TGTFLKNEDI  480
DKCKWSCMFG EVEVPVEVLA DGTLRCYAPP HKPGRVPFYV TCSNRLACSE VREFEFRSTD  540
AHYMETSDSS ISSINDMHLH IRLEKLLTLG PVDQQKGVSN VTKEKIDLNN KVSALMMDDD  600
EWSSLLKVTD EKEVSIEQAK DQLAEKLIKE KLHSWLIMKI YEEEGKGPNI LGKEGQGVIH  660
LTAALGYDWA IRPIIVAGVN VNYRDVHGWT ALHWAAFCGR ERTVVALIAM GAAPGALTDP  720
TPEFPAGRTP ADLASANGHK GIAGFLAESS LTSHLNALTL KDSKGSDVAE ICGLPSLEDV  780
PGKVPCQLSE GDDGQGGSLK DSLSAVRNAS QAAARIYQVF RVQSFHRKKL VEYGDEKCGV  840
SDERALSLIS VKSAKPGQHD MPLQSAAIRI QNKFRGWKGR KEFLLIRQRI VKIQAHVRGH  900
QVRKQYRKIV WSVGIVEKAI LRWRRKGCGL RGFRPEGLIE GPSMQIQAAK TDDYDFLQEG  960
RRQSEARLQT ALARVKSMVQ YPEARDQYRR LLTVVTELQE SKAAQDKLLS DIEGAADGDF  1020
MVELEQLWQD DTPMPSI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00042PBMTransfer from AT2G22300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008795548.10.0PREDICTED: calmodulin-binding transcription activator 3-like isoform X2
SwissprotQ8GSA70.0CMTA3_ARATH; Calmodulin-binding transcription activator 3
TrEMBLM0T5T80.0M0T5T8_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P10390_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60838140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22300.20.0signal responsive 1