PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco009353.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 281aa    MW: 29744 Da    PI: 6.7188
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco009353.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.53.9e-1096138850
                  HCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   8 rrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                  +r   NReA r++R++Kka ++ Le++v++L a N++L  +l+
  Aco009353.1  96 KRPFGNREAVRKYREKKKAHTASLEDEVAQLRAMNEQLTRRLQ 138
                  67777*********************************98887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.6E-1583157No hitNo description
SMARTSM003389.9E-1089156IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.74991138IPR004827Basic-leucine zipper domain
PfamPF077163.4E-1591146IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.96E-896139No hitNo description
CDDcd146868.85E-13101148No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MEESELDFSN PEVFSSHNVG NTPTSCSMDS FFDEILKDTH HHSCTHTHTC NPPGRDLSHT  60
HTCFHVHTKI LSSPADQSAD SAEKSPSKSP SASSKKRPFG NREAVRKYRE KKKAHTASLE  120
DEVAQLRAMN EQLTRRLQGQ AALEAEVARL RCLLVDIRGR IEGEIGSFPY QKIARAGAEV  180
GGRSVSDMRQ GNLIGGGGGG GGGGAQVVNS CDFPCDDQMY CFNVGVQGRA VGENGAVNGQ  240
GFGVCEMANV ECMGNGSKSF VGCGPGSVMT AGCSSNAEKN *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6631527e-90KM663152.1 Ananas bracteatus clone 47432 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009391011.11e-121PREDICTED: uncharacterized protein LOC103977271
RefseqXP_009391012.11e-121PREDICTED: uncharacterized protein LOC103977271
SwissprotQ8VY769e-82BZP19_ARATH; Basic leucine zipper 19
TrEMBLM0SAN51e-121M0SAN5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P00670_0011e-121(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41753572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35040.11e-68bZIP family protein