PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco009314.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family BES1
Protein Properties Length: 803aa    MW: 89153.4 Da    PI: 5.5689
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco009314.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822129.93e-4064153191
       DUF822   1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspe 91 
                  gg++r++  +E+E++k+RER+RRai+a+i+aGLR++Gny+l++raD+neV++AL+reAGwvv +DGtt++ +s+   ++++  +s+s s+ 
  Aco009314.1  64 GGGRRSRGREEKERTKLRERHRRAITARILAGLRRHGNYNLRVRADINEVIAALAREAGWVVLPDGTTFPSSSSSS-HSHSHSHSHSHSQA 153
                  58899999**************************************************************887777.55555555555554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056873.0E-3565155IPR008540BES1/BZR1 plant transcription factor, N-terminal
SuperFamilySSF514453.06E-188249691IPR017853Glycoside hydrolase superfamily
Gene3DG3DSA:3.20.20.801.0E-206250685IPR013781Glycoside hydrolase, catalytic domain
PfamPF013732.5E-115256675IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.7E-75287301IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.7E-75308326IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.7E-75330351IPR001554Glycoside hydrolase, family 14
PROSITE patternPS005060334342IPR018238Glycoside hydrolase, family 14, conserved site
PRINTSPR008422.0E-9413422IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007501.7E-75423445IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.7E-75496515IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.7E-75530546IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.7E-75547558IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.7E-75565588IPR001554Glycoside hydrolase, family 14
PRINTSPR008422.0E-9568578IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007501.7E-75605627IPR001554Glycoside hydrolase, family 14
PRINTSPR008422.0E-9656670IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR008422.0E-9671685IPR001371Glycoside hydrolase, family 14B, plant
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000272Biological Processpolysaccharide catabolic process
GO:0048831Biological Processregulation of shoot system development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016161Molecular Functionbeta-amylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 803 aa     Download sequence    Send to blast
MAREMEKLGG GGGGVPSEDD DDDEEMEVKE EEEEDDDDGG GGDDLDDDAE GEVVVVGGMG  60
GVGGGGRRSR GREEKERTKL RERHRRAITA RILAGLRRHG NYNLRVRADI NEVIAALARE  120
AGWVVLPDGT TFPSSSSSSH SHSHSHSHSH SQAARLAGAG EGAPPATAPP LRGVSPAGAS  180
FRTLDYRTGR LRGVFTPSPS PSPSPSSSSF LPRCVPIRSP ADDLLLSGDN KQGMDARGRA  240
LVPDREYVGT PCIPVYVMLP LGVINMKCEM ADPEGLVKYL EELKSINVDG VMVDCWWGIV  300
EAHSPGKYNW DGYKELFRIV SEMKLKLQAV MSFHECGGNV GDDVTIPLPS WVIEIGNSNQ  360
DIYFTDREGR RNTECLSWGI DKERVLKGRT ALEVYFDYMR SFRVEFNQFF ENGVISDVEI  420
GLGPCGELRY PSYPAKNGWR YPGIGEFQCY DKYLMRSLRK AAEARGHTFW ATGPDNAGTY  480
TSQPHETEFF SDGGSYDSYY GRFFLGWYSQ VLVDHADRVL SLAKLAFEGS QIAAKISGVH  540
WWYKTASHAA ELTAGFYNPC NRDGYAAIAA VLKKHGVALN FTCVELRTLD HNMDYPDAMA  600
DPEGLVWQVV NAAWDAGILV ASENALPCYD RDGYNKILEN AKPLDDPDGR HLIAFTYLRL  660
SPTLLERQNF LEFERFVKQM HGEAVLDILL LYKAPFTPKN LSLQRWCGLA MDTKAKDGDA  720
EQPTKTPKEE PALFDPSRMI GIIKRKALIK ELAAAYHTEC VAHCQELLQL QRKWEELQYI  780
ERKASEDTKQ LTKPSKRPKK GL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1bya_A1e-15725368312444BETA-AMYLASE
1byb_A1e-15725368312444BETA-AMYLASE
1byc_A1e-15725368312444BETA-AMYLASE
1byd_A1e-15725368312444BETA-AMYLASE
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6657790.0KM665779.1 Ananas bracteatus clone 50966 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020112780.10.0beta-amylase 2, chloroplastic
SwissprotO808310.0BAM7_ARATH; Beta-amylase 7
TrEMBLA0A199W4E50.0A0A199W4E5_ANACO; Beta-amylase
STRINGXP_010255371.10.0(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21413663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.10.0beta-amylase 7
Publications ? help Back to Top
  1. Soyk S, et al.
    The Enzyme-Like Domain of Arabidopsis Nuclear β-Amylases Is Critical for DNA Sequence Recognition and Transcriptional Activation.
    Plant Cell, 2014. 26(4): p. 1746-1763
    [PMID:24748042]