PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco008812.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family CPP
Protein Properties Length: 781aa    MW: 85224.2 Da    PI: 6.4168
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco008812.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.15.4e-16465503240
          TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  ++k+C+CkkskClk+YCeCfaag++Cse C C++C+Nk 
  Aco008812.1 465 SCKRCSCKKSKCLKLYCECFAAGVYCSEPCACQGCFNKP 503
                  689**********************************96 PP

2TCR49.11.1e-15550588139
          TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                  ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce CkN 
  Aco008812.1 550 RHKRGCNCKKSSCLKKYCECYQGGVGCSISCRCEACKNA 588
                  589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.8E-18464505IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.046465590IPR005172CRC domain
PfamPF036389.4E-12467502IPR005172CRC domain
SMARTSM011144.2E-16550591IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.8E-11552588IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 781 aa     Download sequence    Send to blast
MDTPERSTVG AAAISKFEDS PVFNFINSLS PIQMVKSIDS VQSIQAYQSL NFASIPSIFT  60
SPHANTQKDS KLSARNPFKE LSEQETSSVT CLLNEALVDP PDDSSIVPTN LPQPLQFDGG  120
SPNHSTTPRH GAKTDHVQSN LNLFQSSLDK RKSLFAPERE IGENHPANQE NNEVVGLDWT  180
NLMSDNVDDL LIYNLSIEVD ICRAVDGKQG LGDVNYSDFF SSKYAGEIND SQKTQPDVLS  240
APCVQNVTEN PHVLCDEMFG KEDDMDHTPE ILSGGPNQVV PIDHIQENLN EASDCIPLGY  300
KVDSQQQRGM RRRCLVFEAA GLSKKNTGNV KPRSAISITS KGKMASYDSH LNPLKTPSPR  360
VLPGIGLHLN ALATTSKDRM VTQDTLASGK QLISMPCTIG SFVSTGQKTE SKSQPVAKDF  420
VHTGSEFQEP QVMNNETSPP TVLENAEESS PKKKRRKLEN GEGESCKRCS CKKSKCLKLY  480
CECFAAGVYC SEPCACQGCF NKPIHEETVL STRKQIESRN PLAFAPKVIR TSETGQELGE  540
VSDKTPASAR HKRGCNCKKS SCLKKYCECY QGGVGCSISC RCEACKNAFG RKDGSTPGGA  600
EEIEHGEEEK DAHEKKEEMP DDGQQNASVQ NHENHSSENL AITPFKACRQ LVKLSYFSSS  660
KPPRPSAPTG YFSRLYNTQA LLKSEAMLLC NKFENHVNNF CDDDTANILK ENGSPSNVMK  720
TSSPNGKRIS PSNGVGFSPS RKGGRKLILR SIPSFPSLSN VDSDDAVNDT TNSFNPSTLT  780
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1546758712120Protein lin-54 homolog
5fd3_B1e-1546758712120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1450457PKKKRRKL
2451455KKKRR
3451456KKKRRK
4452456KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020095327.10.0protein tesmin/TSO1-like CXC 2
TrEMBLA0A199UST60.0A0A199UST6_ANACO; Protein tesmin/TSO1-like CXC 2
STRINGXP_008789994.10.0(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.12e-91TESMIN/TSO1-like CXC 2