PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco008682.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MYB
Protein Properties Length: 818aa    MW: 91906.1 Da    PI: 8.3302
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco008682.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding46.31e-14453496448
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      WT+eEd  l  av+ +G ++W ++a++m   Rt+ qc +rw+k l
      Aco008682.1 453 WTEEEDITLCAAVETFGDNNWQAVASHMD-SRTGPQCSNRWRKTL 496
                      *****************************.************975 PP

2Myb_DNA-binding52.41.2e-16504548247
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      grW+ +Ed++l+ av ++G ++W++Ia+  + gRt  qc++rw++ 
      Aco008682.1 504 GRWSVDEDKRLKVAVMLFGAKNWNKIAQFAP-GRTQVQCRERWLNC 548
                      8******************************.***********996 PP

3Myb_DNA-binding49.97.1e-16556600248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      ++WT+eEd +l++a++++G   W++Ia++++  Rt+ qc+ rw  +l
      Aco008682.1 556 QAWTAEEDSKLLEAINEHGYC-WSRIAACIP-PRTDSQCRRRWKVLL 600
                      68*****************99.*********.9**********9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.121295389IPR017877Myb-like domain
SMARTSM007170.044299393IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.7E-10301318IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.7E-10363404IPR009057Homeodomain-like
SuperFamilySSF466894.61E-11389447IPR009057Homeodomain-like
PROSITE profilePS500908.095392444IPR017877Myb-like domain
SMARTSM007170.0026396446IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-11405450IPR009057Homeodomain-like
SuperFamilySSF466892.92E-20429499IPR009057Homeodomain-like
PROSITE profilePS5129420.164445500IPR017930Myb domain
SMARTSM007177.8E-13449498IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-16451498IPR009057Homeodomain-like
PfamPF002491.3E-12452495IPR001005SANT/Myb domain
CDDcd001671.26E-11453496No hitNo description
SuperFamilySSF466899.9E-29500596IPR009057Homeodomain-like
PROSITE profilePS5129413.108501549IPR017930Myb domain
SMARTSM007172.1E-14502551IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-18504552IPR009057Homeodomain-like
PfamPF002491.8E-15504548IPR001005SANT/Myb domain
CDDcd001673.47E-12505547No hitNo description
PROSITE profilePS5129422.623550604IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.0E-18553600IPR009057Homeodomain-like
SMARTSM007172.0E-14554602IPR001005SANT/Myb domain
PfamPF002492.0E-14556600IPR001005SANT/Myb domain
CDDcd001671.31E-13557600No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 818 aa     Download sequence    Send to blast
MASYASSDSD RDDALDEDME ALRRACMLTG ADPADALGGS DSDSGGESSD SDDLGLLRRL  60
QERFSVPSAA AGASESLPFV KPLSILPQSD SDEEDDFETL RAIQRRFSHY ESDALQRTSE  120
SFVQEADDSG LMSKQGTPDI FPKGGKRGVL SEEYSGSTAK VSHHGENKSL NFNARTLTHS  180
QFPKSAQALV DALKKNRSCQ KFIRRKLIEI EAKIEENKKL KDRVKCLMDF QVACKKTAGH  240
ILCQKKDPRV RLISNQKPSS RQPQKNTCRK LPVLYYGPEE NSQVSKYKLV QERFPVSLRK  300
QPWSNTEREK LAKGIKQQYQ EMLMCNLMNA DSNIEGLHGS DMMPALCSSD LEVPPEKIRS  360
FLPSVNWDRL ATLYLPDRSG EECEARWLNC EDPLINHNPW TMMEDKKLLF IVQEGGVYNW  420
INISISLGTH RTPFQCLARY QRSLNPHILN RDWTEEEDIT LCAAVETFGD NNWQAVASHM  480
DSRTGPQCSN RWRKTLNPDR RKVGRWSVDE DKRLKVAVML FGAKNWNKIA QFAPGRTQVQ  540
CRERWLNCLD PSLNLQAWTA EEDSKLLEAI NEHGYCWSRI AACIPPRTDS QCRRRWKVLL  600
PHEVPLLQAA RQMKRTVLIS NFVDRESERP TIGPNDFTTV ISSKSGETVE KTSSDQTKKM  660
RTKSKRCRKE NSAADGLMES SAGTAEDVRV ERSTKRSSSS SRQRKSRDKS RKTDEENLTT  720
DGIANPSGDN VPANMPGLHG VNSCTAEKMG IKQKRETSSN SRKKSRNESG KSPGDNFTPR  780
SMVNTSANVD SSGLLLYSNG NSHTDENGNT TGVECQH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-293665963159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-293665963159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1657663KKMRTKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008793544.10.0PREDICTED: uncharacterized protein LOC103709816 isoform X3
TrEMBLM0TBT60.0M0TBT6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P31410_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-167myb domain protein 4r1