PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco008623.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family M-type_MADS
Protein Properties Length: 229aa    MW: 24657.9 Da    PI: 7.5115
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco008623.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.56.3e-221765149
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                 k ien+  r+v fskRr+g++ KA+ELS+LC+aevavi+fs++g+ y +
  Aco008623.1 17 KMIENEQARHVCFSKRRAGVFTKASELSTLCGAEVAVIVFSPSGNPYSF 65
                 68******************************************98877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006625.343969IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-31968IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.36E-271079IPR002100Transcription factor, MADS-box
CDDcd002652.97E-321078No hitNo description
PRINTSPR004041.7E-181131IPR002100Transcription factor, MADS-box
PfamPF003194.9E-251965IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-183146IPR002100Transcription factor, MADS-box
PRINTSPR004041.7E-184667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MERKGKGSRG RKKIEMKMIE NEQARHVCFS KRRAGVFTKA SELSTLCGAE VAVIVFSPSG  60
NPYSFGSPAV DPVLDRFLSG GLDRNNVGSD NEEIQKLNQE YMELAKQIEA EKARKERIDE  120
RLRLASQSQE VKWLENIDKL GLDELNQLRD GLLRVKAQVN ERARELLGIH GPPLENLGLG  180
LDLGLGLGLG LGHGMDVGGP SSSSGATERA YPVKAENPSG SGSSSGSV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mnm_A2e-1511761883PROTEIN (MCM1 TRANSCRIPTIONAL REGULATOR)
1mnm_B2e-1511761883PROTEIN (MCM1 TRANSCRIPTIONAL REGULATOR)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020095945.11e-164agamous-like MADS-box protein AGL29
TrEMBLA0A199VA891e-161A0A199VA89_ANACO; Agamous-like MADS-box protein AGL29
STRINGGSMUA_Achr5P01940_0015e-63(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.12e-33AGAMOUS-like 29