PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco008435.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family M-type_MADS
Protein Properties Length: 332aa    MW: 35788.8 Da    PI: 7.4737
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco008435.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF68.94.6e-2280124145
                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
       SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 
                  kri ++  rqv fskRr+g++KKA+ELSvLC+a++av++fs+ gk
  Aco008435.1  80 KRIASEEARQVCFSKRRAGLFKKANELSVLCGADIAVVVFSPAGK 124
                  799****************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004329.0E-3472131IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.9672132IPR002100Transcription factor, MADS-box
CDDcd002651.51E-3773147No hitNo description
SuperFamilySSF554552.75E-2873154IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-207494IPR002100Transcription factor, MADS-box
PfamPF003193.2E-2681128IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-2094109IPR002100Transcription factor, MADS-box
PRINTSPR004048.1E-20109130IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MHYYVRRRYV ASVSHHSNDD EDEDNKQHRT AMMVASAAAA ESSNNNNNNN NNNNCSSSSS  60
KNTYNNKRKQ SLGRQKIEIK RIASEEARQV CFSKRRAGLF KKANELSVLC GADIAVVVFS  120
PAGKPFSFGH PSVPSVLRRF LSPDNPHNHN HSHSAADSTP AAAAAVAAEL NARQAELAAA  180
VEGGRRRRAA LEEALRARRA GMWDADVDAM ALPELEAFAA ALERLRAEAA LRADHLLMLD  240
AAAKGFGAES GGDLYYGGST SYGGGGGGLG LGFDWNNSNN NVIEGKVLML PPPPLPLPLP  300
LPLPPPPPFH HLHGPTHDLQ FEYDADQYGF Y*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A4e-1673147175MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_B4e-1673147175MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_C4e-1673147175MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
1egw_D4e-1673147175MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POLYPEPTIDE A
5f28_A4e-1672147176MEF2C
5f28_B4e-1672147176MEF2C
5f28_C4e-1672147176MEF2C
5f28_D4e-1672147176MEF2C
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9626543e-55EU962654.1 Zea mays clone 244495 DNA binding protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020109333.11e-159agamous-like MADS-box protein AGL61
TrEMBLA0A199UF564e-78A0A199UF56_ANACO; Agamous-like MADS-box protein AGL61
STRINGXP_008788342.17e-55(Phoenix dactylifera)
STRINGXP_008805910.17e-55(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.12e-28AGAMOUS-like 61