PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco008303.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 361aa    MW: 38823.1 Da    PI: 5.4657
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco008303.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.42e-15166213350
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                  ++kr rr+ +NRe+ArrsR+RK+a ++ Le+ v+ L + N +L k+l 
  Aco008303.1 166 DIKRMRRMVSNRESARRSRKRKQAHLADLETQVDRLRGDNASLYKQLT 213
                  58***************************************9996554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.0E-15164228IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.749166218IPR004827Basic-leucine zipper domain
PfamPF001704.9E-13167215IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.38E-12168218No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-12168218No hitNo description
CDDcd147023.36E-19169219No hitNo description
PROSITE patternPS000360171186IPR004827Basic-leucine zipper domain
PfamPF124983.7E-9235343IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MEKATPNPSA GRGGGGGVGD EIGAGMKKSL SELVLEALLQ PQEGGEELLL RPSSENKPRG  60
GGRGGAAVPF ANVCGGDLGF GFGADRDSIS GSINNQLWSH NLNLRHSSVS ATIESPSSIC  120
ALSPTSPHKP NGKENQALGG TSGSEQSDDE SLEELGACEQ SANVVDIKRM RRMVSNRESA  180
RRSRKRKQAH LADLETQVDR LRGDNASLYK QLTDANHQFT DSVTENRILK SDVEALRVKV  240
KMAEDMVTRG ALTCSIDHLL QSHIGSPQIL NTRHPCRASS EVLPNLDFQA DDPCYIGMTN  300
TGQVDNARMD NNIEEMRSRL NQNSPIQSIT SLESLENRIA SEVTSCGADI WQWEARSGTM  360
*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1180186RRSRKRK
2180187RRSRKRKQ
3182187SRKRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010913776.11e-145PREDICTED: basic leucine zipper 9-like isoform X2
TrEMBLK3YUA01e-112K3YUA0_SETIT; Uncharacterized protein
STRINGSb04g005020.11e-107(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20953796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.13e-47basic leucine zipper 9