PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco007958.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 343aa    MW: 38482.6 Da    PI: 9.1707
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco007958.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_121.16.8e-072112571763
                  HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  A+rsR RK+++i+eLe+ v++L+ae  +   e+e l+++   l+ e+
  Aco007958.1 211 AQRSRVRKLQYIAELERNVQALQAEGLEVSAEIEFLSQQNLILDLEN 257
                  89************************999999999999887776665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0022200259IPR004827Basic-leucine zipper domain
CDDcd147035.92E-15201250No hitNo description
SuperFamilySSF579591.62E-5211253No hitNo description
Gene3DG3DSA:1.20.5.1701.1E-5211252No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MASTKGVANV RSSSSAAKQS FLPPKSPFPI VSPSYGDYGS IGSKGNPTHK PREGNNRYHH  60
QRTSSESFLI EEQPSWLDDL LNEPDTPVRK GAHRRSSSDS FAYLEGAAHS LPPWAASAQE  120
YYPQNKVWEP QISSVNYRPS GGPAMKEKVV HHGSSCVSRN ADVAPSNNAS EKNVHEESAQ  180
DSKVSNERKE VSHAKHLQSE VDPKRAKQQF AQRSRVRKLQ YIAELERNVQ ALQAEGLEVS  240
AEIEFLSQQN LILDLENKAL KQRLESLAQE QLIKRFQHEM FEREIARLRS LYQQQQQHLQ  300
AQPAPTHNRS SSRDLDAQFA NLSLKHQDPN TGRDPVSDPL RI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6628560.0KM662856.1 Ananas bracteatus clone 46892a microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010912636.11e-150PREDICTED: uncharacterized protein At4g06598-like
TrEMBLM0TUP21e-124M0TUP2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr8P29390_0011e-124(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP33103666
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G58110.24e-85bZIP family protein