PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco007192.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 313aa    MW: 34096.6 Da    PI: 7.6637
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco007192.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.22.3e-15242285548
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 
                  +r++r++kNRe+A rsR+RK+a++ eLe+kv  Le+eN++L+k+
  Aco007192.1 242 RRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENERLRKQ 285
                  79****************************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000416.2E-7108130IPR001630cAMP response element binding (CREB) protein
Gene3DG3DSA:1.20.5.1702.6E-14235285No hitNo description
PRINTSPR000416.2E-7237253IPR001630cAMP response element binding (CREB) protein
SMARTSM003383.0E-10238294IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.76240285IPR004827Basic-leucine zipper domain
PfamPF001706.3E-13242285IPR004827Basic-leucine zipper domain
CDDcd147071.30E-24242296No hitNo description
SuperFamilySSF579598.75E-11242287No hitNo description
PROSITE patternPS000360245260IPR004827Basic-leucine zipper domain
PRINTSPR000416.2E-7255275IPR001630cAMP response element binding (CREB) protein
PRINTSPR000416.2E-7275292IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MGIQTMTSQG GGGGAPPSPI HNLAKQGSLC NLTLNEVQNH LGEPLHSMNL DELLKSVFPE  60
PMLMDPDSSS APYPTGSGLQ RQGSVTMPRA LSKKTVDEVW KDIQQDNTTD KEEQRPVQER  120
QPTLGEMTLE DFLIKAGVVM EGNMLIGNAG PIGAGDRATG GQDWYQQYQQ QGQQSMMGGG  180
YMASIAIPQQ LGVAVGPVLE SVYSDGQLNI SSPTVGGALS EPQTPGRKRA AAGEMVDKMV  240
ERRQKRMIKN RESAARSRAR KQAYTNELEN KVSRLEEENE RLRKQKELDK ILRSAPPPEP  300
KHLLRRTSSA PI*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008792462.11e-137PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
RefseqXP_008792464.11e-137PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 2
SwissprotQ9LES32e-86AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLC5YZX91e-114C5YZX9_SORBI; Putative uncharacterized protein Sb09g023920
STRINGSb09g023920.11e-114(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27073883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-86ABA-responsive element binding protein 3