PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco007029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family Dof
Protein Properties Length: 363aa    MW: 38823.7 Da    PI: 6.9677
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco007029.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.25e-4052112262
       zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                  +++alkcprCdstntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rk+k ss
  Aco007029.1  52 PDQALKCPRCDSTNTKFCYYNNYSLTQPRYFCKGCRRYWTQGGSLRNVPVGGGCRKKKISS 112
                  6899*****************************************************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2750109IPR003851Zinc finger, Dof-type
PfamPF027011.4E-3353109IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.96656110IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105894IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MEVHSAHHQM ASHIPLEEVL ISCPRPQQQQ QQQQQQNNNN NNNQERKVRP HPDQALKCPR  60
CDSTNTKFCY YNNYSLTQPR YFCKGCRRYW TQGGSLRNVP VGGGCRKKKI SSSSSSSAAA  120
PSSSSSFSSP SSSSSSFKKD LVTTSPNALL PTSLIAPPLS YDPIGLSLTF ARPMRGLGFD  180
DHDTSFLLGN PNPSTTNLGI TTVPASAAND GFLDILRGGF LGNNYPSGFP NLYYGFGGGG  240
CNNGSVKMEG GVSGEGEEGM VLPFEGGDNH NMDGVTQTVG ESCHGSNCNK AMLEGGESKV  300
VMGLQWEMSG DGNNSSSNNN NNNNNNNNNN MMVESAGRDY WNNGVLGPAT TSWHGLINSS  360
LI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6678741e-141KM667874.1 Ananas bracteatus clone 53312a microsatellite sequence.
GenBankKM6678751e-141KM667875.1 Ananas bracteatus clone 53312b microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020114433.10.0dof zinc finger protein PBF-like isoform X2
RefseqXP_020114434.10.0dof zinc finger protein PBF-like isoform X2
TrEMBLA0A199W6J00.0A0A199W6J0_ANACO; Dof zinc finger protein PBF
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47043263
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.17e-36Dof family protein