PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco006659.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TCP
Protein Properties Length: 339aa    MW: 34365.2 Da    PI: 7.1382
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco006659.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP125.94.4e-39661662102
          TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssgkaaksaakskk 99 
                  a+k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+p+i+++tgt++++as+  a+   s a+ + +g+aa+ ++  + 
  Aco006659.1  66 APKRSSNKDRHTKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGTGTIPASALAAAGPISHAAPPAAGAAAAHHKLDEM 163
                  789******************************************************************77744443433333333322222222222 PP

          TCP 100 sqk 102
                  +q 
  Aco006659.1 164 PQG 166
                  222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036347.6E-3171138IPR005333Transcription factor, TCP
PROSITE profilePS5136928.0772126IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:1900056Biological Processnegative regulation of leaf senescence
GO:0005634Cellular Componentnucleus
GO:0000987Molecular Functioncore promoter proximal region sequence-specific DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MDPKGSSKHP QEVPKFHQAL GLPHSSDKRD DPSAGADRER EQQLQLVAAA AAAVAGDKDE  60
SRKQLAPKRS SNKDRHTKVD GRGRRIRMPA LCAARIFQLT RELGHKSDGE TIQWLLQQAE  120
PSIIAATGTG TIPASALAAA GPISHAAPPA AGAAAAHHKL DEMPQGPAAA AAARTNWATM  180
LAGSAANMGR THPGMWPPPP QVGGFNSGFL LSGGVAAAAP SASGLGGPGG GGDGSVGSFM  240
QRMGLHGLEL AGGNLGPMSF ASMLAGQGQQ LPGLELGLSQ DGHMGALNAQ ALSQFYQQMG  300
QGRGGPAGGG GGSAQLQNQQ QQQQQDSTGE DDSEESGQ*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00636PBMTransfer from Glyma.19G095300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6647500.0KM664750.1 Ananas bracteatus clone 49752d microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020106342.10.0transcription factor TCP20
TrEMBLA0A199W0321e-175A0A199W032_ANACO; Transcription factor TCP20
STRINGXP_008790742.11e-127(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28643269
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.15e-43TCP family protein