PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco005438.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family GATA
Protein Properties Length: 203aa    MW: 22056.8 Da    PI: 9.7624
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco005438.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.53.8e-184679134
         GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34
                 C+ Cgt+ TplWR+gp g+k+LCnaCG++yrkk+
  Aco005438.1 46 CVDCGTSITPLWRSGPCGPKSLCNACGIRYRKKR 79
                 ********************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577161.38E-123979No hitNo description
PROSITE profilePS5011412.8484076IPR000679Zinc finger, GATA-type
SMARTSM004014.3E-1240104IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.4E-154480IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.37E-124576No hitNo description
PfamPF003208.5E-164679IPR000679Zinc finger, GATA-type
PROSITE patternPS0034404671IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MAGYTRTSVV RRYTRRRKEE EEEEEPKEEE KVAETRTAKI EASRVCVDCG TSITPLWRSG  60
PCGPKSLCNA CGIRYRKKRK GGGGGGGGSK GDDNGDAANL SPTPINSPAT ASTTSTSAHE  120
TREASAQVWR EEELRRLQKE KQEKVLLLLM QQQQQQQKQK QKLMLRSANA EDRGRGGAGG  180
AKEVAEAALL LMSLSSGFFV PS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020098264.11e-145erythroid transcription factor-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2496835
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49300.12e-11GATA transcription factor 16