PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco005226.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 479aa    MW: 50074.2 Da    PI: 5.0199
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco005226.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.61.8e-15264318357
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                  + k+ rr+ +NRe+ArrsR+RK+a +  Le  v +L  eN++L k+l   ++++ 
  Aco005226.1 264 DAKKMRRMLSNRESARRSRRRKQAHLSDLEGQVSQLRVENSTLLKRLTDVNQKYN 318
                  5799****************************************99999888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.6E-12261317No hitNo description
SMARTSM003381.2E-16262326IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.243264318IPR004827Basic-leucine zipper domain
PfamPF001702.4E-13265317IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.84E-12266317No hitNo description
CDDcd147023.87E-7267318No hitNo description
PROSITE patternPS000360269284IPR004827Basic-leucine zipper domain
PfamPF124981.5E-45333453IPR020983Basic leucine-zipper, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071215Biological Processcellular response to abscisic acid stimulus
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MERVFSVDEM SDPFWVASPA TGAGAVAGGG GGGGGRGSAM NRSPSEWYFQ RFLQEAEEVA  60
APSSSAAAAA AAAAPSNSNL IPNPNHNRAP IPDPRPVPGP GAAASGVLSS GGSLKEGGRG  120
GDDDVVEIKV PADLASAGTY RQPSDAPAAA AAAEEDVDPG EYHALLRQKL NMQCAAVALS  180
RVSAVKPQES SPLADNNSQT SDASQWASQV ASAKGSGTSG GLAPHVLQNS AAAEKPPTSS  240
SSREQSDDDD DGEIETTENM DLTDAKKMRR MLSNRESARR SRRRKQAHLS DLEGQVSQLR  300
VENSTLLKRL TDVNQKYNDA SVDNRLLKAN VETLRAKVKM AEDTVKRVTG ISPLYPTMPD  360
MSSMGMPFSG SPSDATSGDA AVPIQDDSAH FFQPPPNDYH NRINSCLPEM GSAAPATDVA  420
RGPTTGVKMG RTASLQRVAS LEHLQKRICG EPSPSVPWDA SPPTWDPEAP TSNKRDPA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1278285RRSRRRKQ
2280285SRRRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00040PBMTransfer from AT5G28770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6660585e-83KM666058.1 Ananas bracteatus clone 51280 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010936048.11e-149PREDICTED: light-inducible protein CPRF2-like isoform X2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34883878
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G28770.21e-50bZIP family protein