PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco005205.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family CPP
Protein Properties Length: 765aa    MW: 83469.6 Da    PI: 7.9111
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco005205.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.73.5e-16503540340
          TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                  +k+C+CkkskClk+YCeCf ag +Cse C C++C N+ 
  Aco005205.1 503 RKRCSCKKSKCLKLYCECFVAGIYCSEPCACQGCLNRP 540
                  799*********************************75 PP

2TCR47.92.6e-15587625139
          TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                  ++k+gCnCkks+C+kkYCeC++a + Cs +C+Ce+C+N 
  Aco005205.1 587 RHKRGCNCKKSNCQKKYCECYQASVGCSINCRCEGCRNA 625
                  589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011147.3E-17501542IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.101502627IPR005172CRC domain
PfamPF036381.3E-12504539IPR005172CRC domain
SMARTSM011146.0E-15587628IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.6E-10589625IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 765 aa     Download sequence    Send to blast
MKTPDSAKKI GGTAKSKLED SPVYKFLNNL SPIDAVKSVG SLRTVQTLQF GNFAHSSAFS  60
TPHADRQGES GQPIRNPFDE PSKREISLGG FDGSNRCTGG FDGSNRCTGS SSETPLSSCT  120
ASAQEPRSVA CSLNDATIEP PSGSSSLSRN LPPLMQYDAF SPDYNKELCY GVTTDVSADM  180
GPKTVEQVKV VPNCLDNGNI VFGTENVLRE KQIPHQNRDE TVASEWGKYV ASNAGDLSIC  240
DSLTEAEAHL LGQKLADNNH YYYSHKTQAG MSSGYYVQNV TLDPQANIVE MVKKEDRKDH  300
RPQMLSGTNE QIQGRIDKPI DCNTLGCKVG SQQQRGMCRR CLFSGVSGIS EKNGDSDSNV  360
EPSISKTFTG KMASAGNNLK PGTNTPPFVL PNMRFHLHTF ATTSKDRIVS QHALASGQQL  420
ISIPSAIEPF HAPAGDQKSG IESLGVRKEL LLSGSGVQEL QELQGRYDDH SLAIVPASAE  480
KLSQGSPQKK KGKSESCGQA NARKRCSCKK SKCLKLYCEC FVAGIYCSEP CACQGCLNRP  540
IHEEIVLSTR KQIEARNPLA FAPKIIRTSG EGQEIGENSN KTPASARHKR GCNCKKSNCQ  600
KKYCECYQAS VGCSINCRCE GCRNAFGTKN GIVPIVIEEI EHGKQEKDAW EKEMEELQCY  660
ELNVENEEHQ SFENLPMIPF EARRPLAELP NFINAKPLRS SANNAEYTSQ HKFYSHPNPV  720
LYDGASDAAR GKENEPLSYG VKILSPNRKR LSPARDRSGL GHLR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1650362411120Protein lin-54 homolog
5fd3_B2e-1650362411120Protein lin-54 homolog
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6674679e-64KM667467.1 Ananas bracteatus clone 52884 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020092993.10.0CRC domain-containing protein TSO1-like isoform X1
TrEMBLA0A199VQZ80.0A0A199VQZ8_ANACO; CRC domain-containing protein TSO1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.18e-66Tesmin/TSO1-like CXC domain-containing protein