PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco004988.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family M-type_MADS
Protein Properties Length: 437aa    MW: 45315.6 Da    PI: 7.9304
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco004988.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.41.3e-211765149
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                 krien+  rqv fskRrng++ KA+ELS+LC+a+vav++fs+ g+ y +
  Aco004988.1 17 KRIENEDARQVCFSKRRNGVFSKASELSTLCGADVAVVVFSPAGRPYSF 65
                 79******************************************98887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004326.9E-31968IPR002100Transcription factor, MADS-box
PROSITE profilePS5006625.693969IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.88E-261081IPR002100Transcription factor, MADS-box
CDDcd002658.42E-351084No hitNo description
PRINTSPR004046.3E-201131IPR002100Transcription factor, MADS-box
PfamPF003199.9E-261865IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-203146IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-204667IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 437 aa     Download sequence    Send to blast
MAENNRVSRG RQRVQLKRIE NEDARQVCFS KRRNGVFSKA SELSTLCGAD VAVVVFSPAG  60
RPYSFGSPAV DPVIDRFMST ASGQVGLDPS DPVPSDLIPA SSGPSGSTPG FGPSNLAISM  120
TSSFPDGSGP SGSAPGCLDP LGSEPGGSGP SGSTTNQDAY QRGVINRLNQ EYMELARQLE  180
AGKAQKAAID ERIRVAMESS QECQWLNKVD QLNIDELRRL AAALGRVKLM AEARSNELVG  240
GQGSSSSNVV RVDNYTRLPT GRTTTNNRRA GESSSSSNTT LRVPPIQMVN PFGSSGSNPP  300
STIINPNPVD QFYASSSGFN RNTYGGFNPN FGPSFGFDPN LAGGFNPSSG GFHPNPPAGF  360
NPSSGGFHPN LLGGFNPSSG GFNPNPTGGS DPNLVGRFSS NTGGGFGPSS AGFNPESDGG  420
FNPSSSGFNR NPNTST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020092056.10.0serum response factor homolog B-like
TrEMBLA0A199UZU30.0A0A199UZU3_ANACO; Agamous-like MADS-box protein AGL62 (Fragment)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24840.11e-24AGAMOUS-like 61