PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco004987.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family M-type_MADS
Protein Properties Length: 224aa    MW: 24161.5 Da    PI: 9.63
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco004987.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF51.99.5e-172371149
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                 k+ien+  r+ +f+kRr+g++ KA  L +LC+ ++av++fs+ gk y +
  Aco004987.1 23 KKIENENARYASFTKRRTGLFTKACDLATLCGPDIAVLVFSPVGKCYSF 71
                 68********************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.751575IPR002100Transcription factor, MADS-box
SMARTSM004325.7E-241574IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.84E-231690IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-161737IPR002100Transcription factor, MADS-box
PfamPF003195.7E-202471IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-163752IPR002100Transcription factor, MADS-box
PRINTSPR004045.3E-165273IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MLTANEMLSK GKASKGKQRI ELKKIENENA RYASFTKRRT GLFTKACDLA TLCGPDIAVL  60
VFSPVGKCYS FGSPSVDQVV YRYMSGSPPS SAGTRSGPTN EVQKLNQELM ELSKKLEASA  120
AQQAVLQERL RVAAQAGECK WLENVERLGL EELRRLKESL GQLKSQADKR MNELLRGGGP  180
SSSTTGSSRT ALTVTPKNMA NPFEPITLYP DDSSGEGFGS AGF*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020092055.11e-158agamous-like MADS-box protein AGL29
TrEMBLA0A199UZA41e-157A0A199UZA4_ANACO; Agamous-like MADS-box protein AGL62
STRINGGSMUA_Achr4P28260_0011e-55(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122436128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.11e-24AGAMOUS-like 62