PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco004921.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family LBD
Protein Properties Length: 238aa    MW: 25542.1 Da    PI: 7.836
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco004921.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.91.2e-4181071100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrrkC+++Cv+apyfp +qp+kfa+vh++FGasnv kll+++++ +reda++sl+yeA+ar++dPvyG+v+ i+ l+ +l+ql+++l+ +k
  Aco004921.1   8 PCAACKFLRRKCTQGCVFAPYFPPDQPNKFACVHRVFGASNVAKLLNDISPAQREDAVNSLAYEADARLKDPVYGCVAYISLLELRLRQLRVDLHNAK 105
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  Aco004921.1 106 KE 107
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.9927108IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-418105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MSSSSNSPCA ACKFLRRKCT QGCVFAPYFP PDQPNKFACV HRVFGASNVA KLLNDISPAQ  60
REDAVNSLAY EADARLKDPV YGCVAYISLL ELRLRQLRVD LHNAKKELAA YIGPAAFGPF  120
LPSAPAPPPQ FHHPQFQPPM MGLGLAAAAP QLMIRDHSQS QSQSQMVVDA QPMVVVAAAA  180
SDAAQREQEM FRTYDQQQQQ EELARLSSVY DARGVYNHAA QLGGGPTVAI AGSAGLA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4611114114LOB family transfactor Ramosa2.1
5ly0_B1e-4611114114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020091636.11e-172LOB domain-containing protein 36-like
RefseqXP_020091637.11e-172LOB domain-containing protein 36-like
SwissprotQ9FKZ33e-60LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A427A3W72e-74A0A427A3W7_ENSVE; Uncharacterized protein
STRINGGSMUA_Achr6P04670_0012e-73(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61433456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.14e-59ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]