PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco004337.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 250aa    MW: 27471.9 Da    PI: 5.9768
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco004337.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.21.3e-11119166552
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                  kr +r   NR +A+rsR RK+++i eLe+ v +L++e +aL  ++  l
  Aco004337.1 119 KRVKRILANRQSAQRSRVRKLQYISELERSVTTLQTEVSALSPRVAFL 166
                  8999*********************************99998776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.8E-14115179IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.737117173IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-14119173No hitNo description
SuperFamilySSF579597.74E-12119173No hitNo description
PfamPF001702.4E-10119168IPR004827Basic-leucine zipper domain
CDDcd147034.11E-24120170No hitNo description
PROSITE patternPS000360122137IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MAQLPPKVPN ITPTHQPAAP WASEFLGFSA ARRGAHRRSV SDSVAFLEEC VGRGGEGLGG  60
FDNNDDQLMA MFPDDAAPVV SSPSDRSGVN GMPCEEAEPT AGAPPQEETT AAEKIVDPKR  120
VKRILANRQS AQRSRVRKLQ YISELERSVT TLQTEVSALS PRVAFLDHQR SLLTVGNSHL  180
KQRIAALAQD NIFKDAHQEE LKKELERLRE VYYQQKLRNM DAPDFDASVH LEKELLNFEG  240
TTCTLGPTP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009406251.14e-94PREDICTED: transcription factor RF2a-like isoform X1
SwissprotQ5JMK69e-83BZP06_ORYSJ; Basic leucine zipper 6
TrEMBLC0HG108e-87C0HG10_MAIZE; BZIP transcription factor
STRINGAC233853.1_FGP0022e-86(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP132238125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G42380.21e-64bZIP family protein