PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco003270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family ZF-HD
Protein Properties Length: 299aa    MW: 31402.3 Da    PI: 11.4343
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco003270.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer94.49.3e-302373556
  ZF-HD_dimer  5 rYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRre 56
                 rY+eC++NhAa++Gg+a+DGCgEfmp  g+eg+ +alkCaACgCHRnFHRr+
  Aco003270.1 23 RYRECMRNHAAAIGGQAYDGCGEFMPG-GAEGSLEALKCAACGCHRNFHRRN 73
                 8*************************9.999*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015662.4E-272373IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.9E-272373IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.2072473IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-162772IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
MGKGRGEVGA AAEGGGGGAG GGRYRECMRN HAAAIGGQAY DGCGEFMPGG AEGSLEALKC  60
AACGCHRNFH RRNGGADARR AQIAYGWDQR KPIRGRAPPF PRSSPLAPLP APYHAIAPPR  120
RPPLATQHQH TTSTSTPRRT NAGDRQRGRV DDPPPRRERS GRGGDRASRE GASAPSSTAG  180
QKRRCSAFAE KRGVAIKKHD VRGASSSSTS RIRVDTPPST GCISGCTTTR AHLASPSPPH  240
PPLSTPLLLP LHPHRAAVPP PPRRAPNSAA AAPPLLRHPS LKLQLSIEKD CDVFNNNY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1152159PPPRRERS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020107239.11e-154zinc-finger homeodomain protein 2-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02540.13e-20homeobox protein 21