PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco003049.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 182aa    MW: 20695.2 Da    PI: 6.7914
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco003049.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.51.9e-1584143463
                  XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                   +r rr+++NRe+ArrsR RK++ + eL  +v  L + N++L +el++    ++++  e+
  Aco003049.1  84 ERRKRRMISNRESARRSRMRKQKHLSELWARVVHLRGANRQLLDELNRVMRDCDQVVHEN 143
                  689**************************************************9987665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-1781145IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.93283146IPR004827Basic-leucine zipper domain
PfamPF001705.8E-1383138IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.0E-1185138No hitNo description
SuperFamilySSF579596.88E-1285135No hitNo description
CDDcd147028.80E-1986137No hitNo description
PROSITE patternPS00036088103IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MHPGEVASLG YLSQSNPPSF ATHYYVTQSS IPSPFDLSNL FGPYSAPNIY DNIQLVNEVG  60
VPANCNSNSD EGDHEQRTSS LAEERRKRRM ISNRESARRS RMRKQKHLSE LWARVVHLRG  120
ANRQLLDELN RVMRDCDQVV HENTQLRDEK IELQKKLEML EIENTVIMIG GAAEDTCREG  180
K*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
184105RRKRRMISNRESARRSRMRKQK
297104RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00647PBMTransfer from LOC_Os02g49560Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008804405.17e-66PREDICTED: basic leucine zipper 63-like
TrEMBLK3Z0362e-57K3Z036_SETIT; Uncharacterized protein
STRINGSi019897m6e-57(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.17e-33basic leucine-zipper 42