PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco002544.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 146aa    MW: 16730.3 Da    PI: 8.2201
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco002544.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.95e-142281463
                 XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                  k+ +r+++NRe+ArrsR+RK++ ++eL +   +L + Nk+   +l+ l++++ +l++++
  Aco002544.1 22 EKKRKRMISNRESARRSRLRKQQHLDELINQEVKLRNDNKQIEAQLNILTQQYLNLDKDN 81
                 5999****************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-161983IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.9E-102075No hitNo description
PROSITE profilePS5021710.7142177IPR004827Basic-leucine zipper domain
PfamPF001701.4E-92380IPR004827Basic-leucine zipper domain
SuperFamilySSF579599.85E-122377No hitNo description
CDDcd147025.90E-192474No hitNo description
PROSITE patternPS0003602641IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MSSIPAACRS SSPEGCPQIT DEKKRKRMIS NRESARRSRL RKQQHLDELI NQEVKLRNDN  60
KQIEAQLNIL TQQYLNLDKD NIVLRAQVTE LNERLKSMNS LLQIVEDVVG VPMETIPEIP  120
DPLLKPWQPL FPAQPIMANA EFLQF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13541RRSRLRK
23542RRSRLRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009382501.11e-55PREDICTED: ocs element-binding factor 1-like
SwissprotQ9LZP85e-40BZP53_ARATH; bZIP transcription factor 53
TrEMBLM0RPJ41e-55M0RPJ4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P05140_0013e-55(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188635100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.13e-41basic region/leucine zipper motif 53