PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco001785.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 144aa    MW: 17060.7 Da    PI: 10.2414
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco001785.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.51.1e-111777363
                 XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                 ++++++rk++NR +Ar+sR+RK+ ++ +L+++ +eLe  N +   +++++  ++ ++++e+
  Aco001785.1 17 DDRKQKRKESNRNSARKSRERKERYLTQLRKEREELERVNPQIEMRIQMIHSNYLYVDQEN 77
                 689************************************************9999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.2E-81064No hitNo description
SMARTSM003382.3E-81579IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.2661787IPR004827Basic-leucine zipper domain
PfamPF001704.9E-81867IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.16E-81972No hitNo description
PROSITE patternPS0003602237IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1708.3E-46599No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MPPRRYSNPE ADSKLADDRK QKRKESNRNS ARKSRERKER YLTQLRKERE ELERVNPQIE  60
MRIQMIHSNY LYVDQENDKL KREVEKYSEQ LTQLRDLLRL IEMSTGLKLD IPELPDPGST  120
LKSWKLPLLP LPGVNAVKMF QLV*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13138RKSRERKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP188635100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.12e-15basic leucine-zipper 44