PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco001707.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 245aa    MW: 26035.8 Da    PI: 9.4859
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco001707.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1574.3e-18173225557
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                  +r++r++kNRe+A rsR+R++a++ eLe+kv  Le+eN++L+ke ++l+ +v 
  Aco001707.1 173 RRQKRMIKNRESAARSRARRQAYTNELENKVSHLEEENERLRKEQQQLEPLVH 225
                  79**********************************************98776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR000418.6E-6168184IPR001630cAMP response element binding (CREB) protein
SMARTSM003384.6E-15169233IPR004827Basic-leucine zipper domain
PROSITE profilePS5021712.335171221IPR004827Basic-leucine zipper domain
PfamPF001707.4E-16173224IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.38E-13173226No hitNo description
Gene3DG3DSA:1.20.5.1705.4E-17173230No hitNo description
PROSITE patternPS000360176191IPR004827Basic-leucine zipper domain
PRINTSPR000418.6E-6186206IPR001630cAMP response element binding (CREB) protein
PRINTSPR000418.6E-6206223IPR001630cAMP response element binding (CREB) protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGAHTMASQG GGGVGGRQGS AAYGVALDEV ETHLGEPLHS MNLDDLLRHV LPSDLGSTTA  60
SSTAGHSQRH GVEHLVGASA SDIHRGGRRR LPEGGGGGER PPALGEVTLE DFLSRAGAAA  120
EEGGGGGGDS VQRNHHQPGI TGIYVTRPLA PAPAPAPARK RAAAPAAEKT VERRQKRMIK  180
NRESAARSRA RRQAYTNELE NKVSHLEEEN ERLRKEQQQL EPLVHYAPQQ EQKHQLHRTS  240
SAPF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6630740.0KM663074.1 Ananas bracteatus clone 47285 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001295728.12e-55ABSCISIC ACID-INSENSITIVE 5-like protein 2
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.15e-21ABA-responsive element binding protein 3