PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco001636.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 406aa    MW: 43533.6 Da    PI: 6.8008
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco001636.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.57.8e-10208255552
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleel 52 
                  kr++r   NR +A rs +RK  +i eLe+kv++L++e ++L  +l   
  Aco001636.1 208 KRAKRILANRQSAARSKERKARYISELERKVQTLQTEATTLSAQLTLF 255
                  9****************************************9888765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.1E-15204268IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.645206269IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.8E-8208262No hitNo description
SuperFamilySSF579598.44E-11208259No hitNo description
PfamPF001701.2E-8208254IPR004827Basic-leucine zipper domain
CDDcd147034.52E-24209258No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MQPHPTDPPQ PPSRNPNPNH NPSLPFPFPH NAPAPLPTVA PGAPGMFHSL NPAHCAPMRG  60
SSHRRARSEL PFRIPGDLDL SSGDPMSTGS LEEMGSEDDL FCTFMDIEKI GGKLEGSGSG  120
SEGGVCRDRT AESSGRAEDQ TPGNAAAAGA AGAAAPSRPK HRHSSSIDGA SMMSSATTRA  180
EGVFGDVMEA KKAMTADQLA ELAAIDPKRA KRILANRQSA ARSKERKARY ISELERKVQT  240
LQTEATTLSA QLTLFQRDTT GLSAENAELK LRLQAMEQQA QLRDALNEAL KHEVERLKIA  300
TGEITSLGET YNMGLQHISY NNPSFFTLAQ PQPVQHQGVH LQPQFNQSHS NNSPNHQMLP  360
HPNTLPDIMQ QDPLGRLQGL EISKGSLVVK SESPSISASE SSSTF*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00303DAPTransfer from AT2G40620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6620551e-149KM662055.1 Ananas bracteatus clone 45339a microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010921141.11e-175PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P41e-134RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A0E0KDF41e-138A0A0E0KDF4_ORYPU; Uncharacterized protein
STRINGLOC_Os03g21800.11e-132(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26833683
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40620.16e-82bZIP family protein