PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco001114.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family ZF-HD
Protein Properties Length: 110aa    MW: 11775.4 Da    PI: 7.5903
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco001114.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer103.21.8e-3243100360
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 
                   vrY eC+kNhAas+GghavDGC+Efm+  geegt+ al+CaACgCHR+FHRr +e+e
  Aco001114.1  43 VVRYGECQKNHAASIGGHAVDGCREFMAGAGEEGTSGALTCAACGCHRSFHRRLQEYE 100
                  69***************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257749.0E-2542107IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.4E-294497IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015667.5E-274595IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.524696IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 110 aa     Download sequence    Send to blast
MTLLVAEKES SKSIDKMKKC LVVLRGCEPD GRIRCSEACV RRVVRYGECQ KNHAASIGGH  60
AVDGCREFMA GAGEEGTSGA LTCAACGCHR SFHRRLQEYE AACDCSSET*
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269|PubMed:21455630}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020111091.11e-73mini zinc finger protein 2-like
SwissprotQ9LJW58e-32MIF2_ARATH; Mini zinc finger protein 2
TrEMBLA0A199V0Y93e-72A0A199V0Y9_ANACO; Mini zinc finger protein 2
STRINGXP_002534013.12e-32(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.13e-34mini zinc finger 2
Publications ? help Back to Top
  1. Bollier N, et al.
    At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato.
    Plant Cell, 2018. 30(1): p. 83-100
    [PMID:29298836]