PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco001064.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 391aa    MW: 42682.2 Da    PI: 5.7133
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco001064.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.19.3e-0994147560
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklk 60 
                  k  rr+++NReAAr+sR+RKk  +   e  + + + eN+++k  l +l++e ++ +
  Aco001064.1  94 KTLRRLAQNREAARKSRLRKKVGVLYFESSAYVQQLENSRMK--LVQLEQELERAR 147
                  788**********************99998777777777665..777777776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.00490152IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.4E-691148No hitNo description
SuperFamilySSF579595.2E-594135No hitNo description
PROSITE patternPS00036097112IPR004827Basic-leucine zipper domain
PfamPF141447.9E-31187263IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 391 aa     Download sequence    Send to blast
GMSSLDMAGC NVGAGAEAAA AAAAAAEASR FSFPRAVHLE NWGDSAMAVT SPITDTSTDV  60
DNDDRNQIID GGQQGAAACL DSSAVSKGRA GDQKTLRRLA QNREAARKSR LRKKVGVLYF  120
ESSAYVQQLE NSRMKLVQLE QELERARQQG IFIASGFLGE HGYSIGGNGA LAFDMEYTRW  180
LDDHQRQIND LRSALNSQMS DDDLRVLVDA VMAQYDEVFK LKSIGTKSDV FHMLSGMWTT  240
PAERCFMWLG GFRSSELLKI LASHLEPLTD QQLMGICNLQ QSSQQAEDAL SQGMEALQQS  300
LAETLASASL GPCPGSDNVA NYMGQMAIAM GKLGTLENFL RQADLLRQQT LQQMHRILTT  360
RQAARALLAI SDYFSRLRAL SSLWLARPRD *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008788459.10.0PREDICTED: transcription factor TGA2-like
RefseqXP_009417650.10.0PREDICTED: transcription factor HBP-1b(c38)-like
SwissprotQ415581e-178HBP1C_WHEAT; Transcription factor HBP-1b(c1) (Fragment)
TrEMBLM0U0L30.0M0U0L3_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr9P15550_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48638185
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68640.11e-126bZIP family protein