PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco001017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family G2-like
Protein Properties Length: 414aa    MW: 44726.6 Da    PI: 8.2468
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco001017.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.9e-32230283255
      G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                  pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Aco001017.1 230 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 283
                  9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.33E-15227283IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-28228283IPR009057Homeodomain-like
TIGRFAMsTIGR015571.0E-23230283IPR006447Myb domain, plants
PfamPF002497.4E-7231282IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MEAASAPSPD LSLHISPPNS AAAPPSNDKP ARNGGGGSRA YTELSLSPPP PPPPLPTPPT  60
TTTTTPRGLS FGAAPPMQPL HHRAMHDIIG CSSVDSTPIR GIPIYSNSPL PFLPADPKNM  120
GFLHQVWSSS SPSSSSSMAL PPLSDPSGPF LHPVGRAFTA PTTARFNGLL SDSFRAHNHH  180
HHHHYNHNLP HHHHQHQHHQ YGIGSFDAAQ NMMRSRFMAK LPGKRSMRAP RMRWTSTLHA  240
RFVHAVELLG GHERATPKSV LELMDVKDLT LAHVKSHLQM YRTVKTTDRS AASSGQSDGS  300
GEDDLASSTG ADLSFRRFIE QTRASDGGNA ASDMDYSSAS TNPSTKWSNS SRDPGLQTNP  360
CDMDGLRPVR FLSQIENAEA CRSNGSQVTN NELKSPSLEF TLGRPDWHSA EHD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-16231285458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-16231285458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-16231285357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16231285357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16231285357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16231285357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-16231285458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-16231285458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-16231285458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-16231285458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-16231285458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-16231285458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6613000.0KM661300.1 Ananas bracteatus clone 43011 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020081685.10.0probable transcription factor RL9 isoform X1
SwissprotQ0J2352e-78ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A199UN070.0A0A199UN07_ANACO; Putative transcription factor RL9
STRINGXP_008775090.11e-113(Phoenix dactylifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.17e-55G2-like family protein