PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco000921.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family bZIP
Protein Properties Length: 190aa    MW: 21945.5 Da    PI: 8.7826
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco000921.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.65.6e-1394147356
                  XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                  e +r rr+++NRe+ArrsR RK++ + eL   v  L + N++L +el++    +
  Aco000921.1  94 EERRRRRMISNRESARRSRMRKQKHLSELWAQVVHLRSANRQLLDELNRAMRGC 147
                  66899******************************************9977666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.1E-1190147No hitNo description
SMARTSM003382.6E-1592156IPR004827Basic-leucine zipper domain
PfamPF001702.5E-1094144IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.49694157IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.75E-1296144No hitNo description
PROSITE patternPS00036099114IPR004827Basic-leucine zipper domain
CDDcd147021.92E-15101148No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MHPTGEVASI RYLSPSNTPT FKSSHYDAAQ NNMSSFHFGN IFGPCVNQNI HIMQPNHEFS  60
DLHSPPACSV STVSCLRSGS TSDEADDRHR SSEEERRRRR MISNRESARR SRMRKQKHLS  120
ELWAQVVHLR SANRQLLDEL NRAMRGCDRI MHENARLREE RSELQKMVQK LQEEKNLSAQ  180
ENIEETNCK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195116RRRRRMISNRESARRSRMRKQK
2108115RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008804405.11e-59PREDICTED: basic leucine zipper 63-like
SwissprotQ9FMC24e-26BZP43_ARATH; Basic leucine zipper 43
TrEMBLK3Z0361e-47K3Z036_SETIT; Uncharacterized protein
STRINGSi019897m3e-47(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.17e-17basic leucine-zipper 42