PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn386081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 1430aa    MW: 158765 Da    PI: 6.2486
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn386081genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof74.81.1e-2366112450
      zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvP 50 
                 ++l+cprCdst+t+f yynny+ sqPr+ C +Crr Wt+GG+lr v 
  Achn386081  66 DHLTCPRCDSTDTRFLYYNNYNPSQPRHHCNSCRRAWTRGGTLRRVK 112
                 6789****************************************996 PP

2zf-Dof53.84e-17385428346
      zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGal 46 
                  ++l+cprC+stntkf yy n slsqPr++C +C   Wt+GG++
  Achn386081 385 PEHLPCPRCNSTNTKFIYYCNNSLSQPRHYCSSCCESWTQGGTI 428
                 57899*************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-1661111IPR003851Zinc finger, Dof-type
PfamPF027019.0E-2267114IPR003851Zinc finger, Dof-type
PROSITE profilePS5088421.69768122IPR003851Zinc finger, Dof-type
PfamPF027014.9E-16387429IPR003851Zinc finger, Dof-type
PROSITE profilePS5088417.681388442IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-8392428IPR003851Zinc finger, Dof-type
Gene3DG3DSA:1.10.8.505.6E-2412891360No hitNo description
HamapMF_0131523.18612891428IPR001892Ribosomal protein S13
SuperFamilySSF469462.63E-3412901425IPR010979Ribosomal protein S13-like, H2TH
PfamPF004168.0E-5412911419IPR001892Ribosomal protein S13
PROSITE profilePS5015934.91512921422IPR001892Ribosomal protein S13
Gene3DG3DSA:4.10.910.104.5E-2113831426IPR02743730s ribosomal protein S13, C-terminal
PROSITE patternPS00646013981411IPR018269Ribosomal protein S13, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0006412Biological Processtranslation
GO:0005618Cellular Componentcell wall
GO:0005730Cellular Componentnucleolus
GO:0005774Cellular Componentvacuolar membrane
GO:0005886Cellular Componentplasma membrane
GO:0009506Cellular Componentplasmodesma
GO:0022627Cellular Componentcytosolic small ribosomal subunit
GO:0003677Molecular FunctionDNA binding
GO:0003723Molecular FunctionRNA binding
GO:0003735Molecular Functionstructural constituent of ribosome
Sequence ? help Back to Top
Protein Sequence    Length: 1430 aa     Download sequence    Send to blast
MREGLRSSAK RESGVVPEKD NADSGLNNGE EIESDGENEK RWSCGRGRRR QRVKGGGSYL  60
PDPEPDHLTC PRCDSTDTRF LYYNNYNPSQ PRHHCNSCRR AWTRGGTLRR VKCSWVRVKA  120
REIEGGSENV EQGEGGDVSA DANIWKGQLG RRIRVDSSDK EEDKINLCLE EGDETKKTHG  180
NEMQAQVQNS LDDRKIEGGS DNVKQVEDAD VCADGKIGRG GPRRRRVNSS DEEKDVNSGL  240
GDGDYTKNDY DNEMQAQVPN SLEDRIFQGG SDNVGQGEDA DVYIDGKCRR GRPGRERRKV  300
GDSVKEKNEV NSCPKEGYEA KNTGPNFTDP NCVEDSMPSS LEKKVEGERN GREAEHMECN  360
EEAYANAHGD NHTDTGGMHP PGPEPEHLPC PRCNSTNTKF IYYCNNSLSQ PRHYCSSCCE  420
SWTQGGTICS YCPPVKKKRL DCSDEVTDEV NSDLEGDETK KTDANNRQAL VPNSLASSQE  480
RKLEGERNGS EVSEQMECYE ESDVNAHGDN HTGKPRTGRG QKGRKRKLVE GSVRDGEDGT  540
QIKKVKEIPF GGETQVVGRF LRSRTVLMGG GEKMVDGEPV GGVDVKKDSD SLSKKVVDME  600
KDGIAQLIGR GKKKLKGRRG RPPKVFERLQ MLLGVKHQLE EGFSWTLIQR FDVSKDISLS  660
SVPQKVECNS KLAIALSIMD ECFLPIVDQR SGINMMHNVV YSCGIHGNRL AEMPFIGTRH  720
IYRRQGMCRR LLNAIETALC SLDVEKLVIP AIAELLQTWT SVFGFMPLEE SNKKDMEYMN  780
LIVFPGVDML QKPLLNQKFA EENLISIAAT KSMEPITKHH TAHERASDTD MDRSSESDLK  840
VSHEVILDNA PGTSDIAAPV ESTLQLPDVS LNDACDLPSE TMKLKEYVTI ENSLAHSGVT  900
HDNHELENKD IKASEASGVN ALELGGQHTT KEINKEENAH SGSTNMTPDE ISKLNQQRVC  960
VLGVQHKLFF DFLTLSDATN CEGKTLHAKD VSNVFLNAAC DLPKESVKLK ESVTIENCLV  1020
HSRVTHDNQE WQNKDIKDFE ASGVDALEVG GQHAAKEMNK EENAHSRSTN VPPDEISKLN  1080
QLGVSGVELK LSYDFQTLSN VTNCEGNTLY AKDGPDVSLN GTCDLPSETV KSRESVTVEN  1140
YLDHSGVTHD NQAWENKNVK DSESSGLYAI ELVVQHTTKE INREENACSG STTNVTHDVV  1200
SKLNQLSATV SDATNCRVGK ALHAKGPDCQ LNGEVDTADF ICQDSASTNL MHSDGQCRTQ  1260
LQSAAVTRHS SRSETLAMSL VANEEFQHIL RVQNTNVDGK QKIMFALTSI KGIGRRFANI  1320
VCKKADVDMN KRAGELSSQE LDNLMTIVAN PRQFKIPDWF LNRKKDYKDG KFSQVTSNAL  1380
DMKLRDDLER LKKIRNHRGL RHYWGLRVRG QHTKTTGRRG KTVGVSKKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4v3p_SM5e-9112781429115240S ribosomal protein S18
4v7e_BS5e-9112781429115240S ribosomal protein S13
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66940.15e-20Dof family protein