PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn384211
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Dof
Protein Properties Length: 300aa    MW: 32812.3 Da    PI: 8.3218
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn384211genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.77e-401776261
      zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                +e+alkcprCds+ntkfCyynnysl+qPryfCk+CrryWtkGGalrnvP+Ggg+rknkk 
  Achn384211 17 PEQALKCPRCDSSNTKFCYYNNYSLTQPRYFCKTCRRYWTKGGALRNVPIGGGCRKNKKG 76
                6899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-231766IPR003851Zinc finger, Dof-type
PfamPF027011.2E-331975IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.3762175IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102359IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010052Biological Processguard cell differentiation
GO:0010118Biological Processstomatal movement
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1902066Biological Processregulation of cell wall pectin metabolic process
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MSPEKSAESG GGRKGPPEQA LKCPRCDSSN TKFCYYNNYS LTQPRYFCKT CRRYWTKGGA  60
LRNVPIGGGC RKNKKGSKSS SSSSFSGDDS KIPGGLKLFH GLSPAMDFQL SSGGLSLPRL  120
HYNQFSSFTD ISSNTSSSTP TTLCFPDGFG NSSSLMGLNF SPLSSVQEMG CSMNITSSIE  180
SLSSINQDLH WKLQQHRFAM LFGQNKEIGS DDHVERPQVQ PIMFQNLEIS KPEACGDHHV  240
GGSRKESGNN NIATEWFFDS SYGQVNPNPT NMSSTNNGNE STRSNWAWTH DLNQYSSLP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7269978e-53KJ726997.1 Zea mays clone pUT3969 C2C2-DOF transcription factor (DOF24) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007047735.11e-104PREDICTED: dof zinc finger protein DOF5.7 isoform X1
TrEMBLA0A2R6RJ300.0A0A2R6RJ30_ACTCH; Dof zinc finger protein like
STRINGEOX918921e-103(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.11e-49Dof family protein