PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn376241
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family TCP
Protein Properties Length: 122aa    MW: 13450.4 Da    PI: 7.5122
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn376241genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP77.53.6e-241171565
         TCP  5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt 65
                +++++++h kv+gRdRRvR++++caa +F+L ++LG+ ++++tieWLl +a+p++  + ++
  Achn376241 11 QKTSKDRHIKVDGRDRRVRIPVKCAALIFELSKRLGHRTAGQTIEWLLHEAEPSVTLAFSN 71
                5789**************************************************9877666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.6E-221370IPR005333Transcription factor, TCP
PROSITE profilePS5136920.2191468IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 122 aa     Download sequence    Send to blast
MCPKSNSSNH QKTSKDRHIK VDGRDRRVRI PVKCAALIFE LSKRLGHRTA GQTIEWLLHE  60
AEPSVTLAFS NPCSVLASLP VFVPPSNPPP PPPVVAPSGE LDNFSFDFDD ANDFMSFPMF  120
F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028052561.12e-27transcription factor TCP8-like
TrEMBLA0A2R6PEX26e-24A0A2R6PEX2_ACTCH; Transcription factor like
STRINGXP_002529440.16e-22(Ricinus communis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08330.14e-22TCP family protein