PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn372131
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family TCP
Protein Properties Length: 298aa    MW: 31290.9 Da    PI: 5.5164
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn372131genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP661.3e-2031833284
         TCP 32 fFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasn 84
                +F+L++eLG+++d++tieWLl q++pai+++tgt++++a++++ + s  s+++
  Achn372131 31 VFQLTRELGHKSDGETIEWLLHQSEPAIIAATGTGTIPANFSTLNGSIRSGGT 83
                8**************************************99944444444442 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136913.126161IPR017887Transcription factor TCP subgroup
PfamPF036345.4E-1931100IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MEIMLQATLR VIVHNDLPPH PTISGYSLVM VFQLTRELGH KSDGETIEWL LHQSEPAIIA  60
ATGTGTIPAN FSTLNGSIRS GGTTASAPPS KSPVHGGGAT MLGFTGGGLE EFSGEDFMKK  120
RFKEDITSAA EPDRTGMLDR EPCSDPNPGS FRQSFLPAPA MWAVGPATSN GGGEGFWKLP  180
AATALVGAGQ PEHQMWPYKG TPVQRIGVFE FPGSGRFSPV HLVPQAQPVQ QRGLGMSETR  240
GMGNLGSISV NAFSGGGGGG GGRVKLGMNL EQHHHENHQT EQPEASESAD ETPEDSP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027094718.11e-82transcription factor TCP23-like
TrEMBLA0A2R6RP681e-142A0A2R6RP68_ACTCH; Transcription factor like
STRINGXP_009624724.16e-79(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G35560.15e-33TCP family protein