PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn359751
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family NAC
Protein Properties Length: 259aa    MW: 29269.8 Da    PI: 6.1622
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn359751genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM137.21.1e-42101311129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrF P+deelv++yL kk+++++     v+k +d+++++ ++L    k +++ewyfFs rd+kyatg r+nrat+sgyWkatgkd+++++  +++
  Achn359751  10 LPPGFRFYPSDEELVCHYLYKKIANEQ-----VLKGTDLVEIDLHTLA---KPNSNEWYFFSFRDRKYATGYRANRATTSGYWKATGKDRTIHDPrTRA 100
                 79**********************998.....5789999999999996...44679**************************************95566 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                   g +ktLvfy++rap+g kt W+mhe+rle
  Achn359751 101 IAGKRKTLVFYRNRAPNGIKTGWIMHEFRLE 131
                 689*************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-518149IPR003441NAC domain
PROSITE profilePS5100547.6310149IPR003441NAC domain
PfamPF023651.3E-2611130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MGLRDIGASL PPGFRFYPSD EELVCHYLYK KIANEQVLKG TDLVEIDLHT LAKPNSNEWY  60
FFSFRDRKYA TGYRANRATT SGYWKATGKD RTIHDPRTRA IAGKRKTLVF YRNRAPNGIK  120
TGWIMHEFRL ENPHVTPKED WVLCRVFHKS NGSKNSPPNV LDSVTDQTMI TSFSQTPPHQ  180
NQNPNDSTIQ NPSALSPNLL QLSRDIINDA SIDEVNSKCD DEYGFLFDLG FEESCLGGGV  240
PQNLEEMICD DDGSLVFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-41915519174NAC domain-containing protein 19
3swm_B5e-41915519174NAC domain-containing protein 19
3swm_C5e-41915519174NAC domain-containing protein 19
3swm_D5e-41915519174NAC domain-containing protein 19
3swp_A5e-41915519174NAC domain-containing protein 19
3swp_B5e-41915519174NAC domain-containing protein 19
3swp_C5e-41915519174NAC domain-containing protein 19
3swp_D5e-41915519174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_028111304.11e-131NAC domain-containing protein 21/22-like
SwissprotQ9FLJ23e-51NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A2R6PPA40.0A0A2R6PPA4_ACTCH; Protein CUP-SHAPED COTYLEDON 3 like
STRINGEOX944241e-119(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.12e-80NAC domain containing protein 74
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]