PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn355701
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family SBP
Protein Properties Length: 421aa    MW: 46626.6 Da    PI: 9.9016
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn355701genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.76.1e-42131207177
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                 +Cqv+gC++dls+ k+yh+rhkvC+vhsk++ v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Achn355701 131 VCQVHGCNKDLSSSKDYHKRHKVCDVHSKTARVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQ 207
                 6**************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-33127193IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.693129206IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.63E-40130210IPR004333Transcription factor, SBP-box
PfamPF031101.5E-31132205IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MSVGWKIKSP YNSHNMELGF PEMMRKSIPS NPNLDTLGGE TENSISTTLT SMTTSNPTFG  60
ELGSGIGFSS PSIASDTQKT SLVEMKLGKF DGWKDAKNSR FSNERSVLTS VGSSLSSKRA  120
RTVNLYSQIP VCQVHGCNKD LSSSKDYHKR HKVCDVHSKT ARVIVNGIEQ RFCQQCSRFH  180
LLAEFDDGKR SCRKRLAGHN ERRRKPQLAT LSGKPYQKLL QYHEDTRFLR TSLPKRSSFV  240
FSDILPGGFF NPQGNVTNVQ DNQSSHIKVK DLPIYRPQFS MPTRNHLGIQ FPSENFPSQQ  300
TGYNPASTVQ ESSGVSNSSS ALSLLSAQSQ DLSSHLTAIP MGFCPVGVSN SMPVIFGANG  360
GIDFEVEASG IRRRSDYVKA KLGPTVDLVQ LSSYLQRVEQ QRNSMHMKQE NDFFCSFPAI  420
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-30127205684squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010650027.11e-133PREDICTED: squamosa promoter-binding-like protein 6 isoform X2
RefseqXP_010650031.11e-133PREDICTED: squamosa promoter-binding-like protein 6 isoform X3
RefseqXP_019074698.11e-133PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A2R6P3Z00.0A0A2R6P3Z0_ACTCH; Squamosa promoter-binding-like protein
STRINGVIT_01s0011g00130.t011e-133(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68311933
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.17e-51SBP family protein